ELK4 Antibody - N-terminal region (ARP34509_P050)

Catalog No: ARP34509_P050

WB Suggested Anti-ELK4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ELK4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Guinea Pig: 86%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 86%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: LNFSEVSSSSKDVENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNS
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-ELK4 (ARP34509_P050) antibody is Catalog # AAP34509 (Previous Catalog # AAPY00531)
• Reference: Mo,Y., (2001) J. Mol. Biol. 314 (3), 495-506

Target Info

• Gene Symbol: ELK4
• Gene Full Name: ELK4, ETS-domain protein (SRF accessory protein 1)
• Alias Symbols: SAP1
• NCBI Gene Id: 2005
• Protein Name: ETS domain-containing protein Elk-4
• Description of Target: The ELK4 gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by ELK4 is phosphorylated by the kinases, MAPK1 and MAPK8. This gene is a member of the Ets family of transcription factors and of the ternary complex factor (TCF) subfamily. Proteins of the TCF subfamily form a ternary complex by binding to the the serum response factor and the serum reponse element in the promoter of the c-fos proto-oncogene. The protein encoded by this gene is phosphorylated by the kinases, MAPK1 and MAPK8. Several transcript variants have been described for this gene.
• Uniprot ID: P28324
• Protein Accession #: NP_001964
• Nucleotide Accession #: NM_001973
• Protein Size (# AA): 431
• Molecular Weight: 47kDa
• Protein Interactions: MAPK8; MAPK3; ELAVL1; ID1; MAPK11; MAPK7; SRF; ID2; ID3; FOS; BRCA1; MAPK14;