EIF2AK1 Antibody - N-terminal region (ARP42405_P050)

Catalog No: ARP42405_P050

Host: Rabbit
Target Name: EIF2AK1
Sample Type: Human Hela
Antibody Dilution: 1.0ug/mlEIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in HeLa

Host: Rabbit
Target Name: EIF2AK1
Sample Type: Human 293T
Antibody Dilution: 1.0ug/mlEIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells

Host: Rabbit
Target: EIF2AK1
Positive control (+): Hela (HL)
Negative control (-): Human brain (BR)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Additional Information: IHC Information: Brain, cerebellum
  IHC Information: Lung
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF2AK1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: TCSDEFSSLRLHHNRAITHLMRSAKERVRQDPCEDISRIQKIRSREVALE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EIF2AK1 (ARP42405_P050) antibody is Catalog # AAP42405 (Previous Catalog # AAPP11557)
• Sample Type Confirmation:

  EIF2AK1 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, HeLa

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Target Info

• Gene Symbol: EIF2AK1
• Gene Full Name: Eukaryotic translation initiation factor 2-alpha kinase 1
• Alias Symbols: HCR, HRI, hHRI, LEMSPAD
• NCBI Gene Id: 27102
• Protein Name: Eukaryotic translation initiation factor 2-alpha kinase 1
• Description of Target: EIF2AK1 acts at the level of translation initiation to downregulate protein synthesis in response to stress. The protein is a kinase that can be inactivated by hemin. Two transcript variants encoding different isoforms have been found for this gene.The HRI gene is localized to 7p22 where its 3' end slightly overlaps the 3' end of the gene JTV1. The two genes are transcribed from opposite strands. Studies in rat and rabbit suggest that the HRI gene product phosphorylates the alpha subunit of eukaryotic initiation factor 2. Its kinase activity is induced by low levels of heme and inhibited by the presence of heme. Sequence Note: The sequence AF181071.1 is a chimeric mRNA clone. Only the heme-regulated initiation factor 2-alpha kinase region was propagated into this RefSeq record.
• Uniprot ID: Q9BQI3
• Protein Accession #: NP_055228
• Nucleotide Accession #: NM_014413
• Protein Size (# AA): 630
• Molecular Weight: 71 kDa
• Protein Interactions: MDM2; UBC; HSP90AA1; LIG4; CDC37; EIF2AK1; EIF2S1;