EED Antibody - N-terminal region (ARP35697_P050)

Catalog No: ARP35697_P050

WB Suggested Anti-EED Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: OVCAR-3 cell lysateEED is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells

Host: Rabbit
Target Name: EED
Sample Type: Human Fetal Heart
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: EED
Sample Type: Human Fetal Lung
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: EED
Sample Type: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: EED
Sample Type: Human Fetal Muscle
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: EED
Sample Type: Human Fetal Stomach
Antibody Dilution: 1.0ug/ml

Host: Rabbit
Target Name: EED
Sample Tissue: Human A549 Whole Cell
Antibody Dilution: 1ug/ml

Sample Type : Rat Brain lysate
Dilution:
1:500

Product Info

• Tested Species Reactivity: Human, Rat
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IF, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EED
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: GDENDDAVSIESGTNTERPDTPTNTPNAPGRKSWGKGKWKSKKCKYSFKC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-EED (ARP35697_P050) antibody is Catalog # AAP35697 (Previous Catalog # AAPP06943)
• Sample Type Confirmation:

  EED is strongly supported by BioGPS gene expression data to be expressed in OVCAR3

• Reference: Rakotobe,D., (er) Virol. J. 5, 32 (2008)
• Publications:

  Long noncoding RNA TUG1 is downregulated in non-small cell lung cancer and can regulate CELF1 on binding to PRC2. BMC Cancer. 16, 583 (2016). 27485439

Target Info

• Gene Symbol: EED
• Gene Full Name: Embryonic ectoderm development
• Alias Symbols: HEED, COGIS, WAIT1
• NCBI Gene Id: 8726
• Protein Name: Polycomb protein EED
• Description of Target: EED is a member of the Polycomb-group (PcG) family. PcG family members form multimeric protein complexes, which are involved in maintaining the transcriptional repressive state of genes over successive cell generations. This protein interacts with enhance
• Uniprot ID: O75530
• Protein Accession #: NP_003788
• Nucleotide Accession #: NM_003797
• Protein Size (# AA): 441
• Molecular Weight: 50kDa
• Protein Interactions: PINK1; BRCA1; ADAM17; EZH2; IMP3; PSPC1; NAT10; PBRM1; RIF1; RBM28; HEATR1; MAGOHB; ARGLU1; MRPL20; NRDE2; CASZ1; BCOR; EXOSC4; LUC7L3; SF3B6; NOP58; SRRT; RAB14; C9orf114; CRNKL1; DDX47; HP1BP3; MYEF2; TRA2A; CPSF1; IGHV3-23; UTP20; PRPF19; ZNF638; RBMX;