- Description of Target:
- Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. DYNLL1 is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity.Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized.
- Gene Symbol:
- DYNLL1
- Official Gene Full Name:
- Dynein, light chain, LC8-type 1
- Alias Symbols:
- DLC1; DLC8; DNCL1; DNCLC1; LC8; LC8a; MGC126137; MGC126138; PIN; hdlc1
- Tissue Tool:
- Find tissues and cell lines supported to express DYNLL1.

- Protein Accession# :
- NP_001032583
- Nucleotide Accession#:
- NM_001037494
- Swissprot Id:
- P63167
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Protein Size (# AA):
- 89
- Molecular Weight:
- 10kDa
- Application:
- WB
- Partner Proteins:
- E2F4, CD99, RB1, env, nef, vif, BSG, CD99, ITK, JAK2, PPIA, PPP3R1, PRLR, PRR13, PRSS23, PTPRN, RB1, S100A8, SUPT5H, ITK, JAK2, N, PPP3CA, PPP3R1, PRLR, PRR13, PRSS23, S100A8, Supt5h, YY1
- Immunogen:
- The immunogen for anti-DYNLL1 antibody: synthetic peptide directed towards the N terminal of human DYNLL1
- Product Format:
- Lyophilized powder
- Purification:
- Affinity Purified
- Complete computational species homology data:
- DYNLL1 antibody - N-terminal region (ARP51350_P050)
- Predicted Homology Based on Immunogen Sequence:
- Bovine: 100%; Chicken: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Zebrafish: 100%; African clawed frog: 92%
- Datasheets / Downloads:
- Printable datasheet for
anti-DYNLL1 antibody
- ARP51350_P050 - Peptide Sequence:
- Synthetic peptide located within the following region: MCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY
- Blocking Peptide:
- For anti-DYNLL1 antibody is Catalog # AAP51350 (Previous Catalog # AAPP28705)
- Key Reference:
- Song,C., (2008) J. Biol. Chem. 283 (7), 4004-4013
- Reconstitution and Storage:
- Add 50 μl of distilled water. Final anti-DYNLL1 antibody concentration is 1 mg/ml in PBS buffer. For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Product Protocols: DYNLL1 antibody tested with Human Transfected 293T Cells (ARP51350_P050)
Aviva Systems Biology is the original manufacturer of this DYNLL1 antibody (ARP51350_P050)
Click here to view the DYNLL1 antibody Western Blot Protocol
Product Datasheet Link: DYNLL1 antibody (ARP51350_P050)
WB Suggested Anti-DYNLL1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
Western Blot image: 
Description of Target: Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. DYNLL1 is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity.Cytoplasmic dyneins are large enzyme complexes with a molecular mass of about 1,200 kD. They contain two force-producing heads formed primarily from dynein heavy chains, and stalks linking the heads to a basal domain, which contains a varying number of accessory intermediate chains. The complex is involved in intracellular transport and motility. The protein described in this record is a light chain and exists as part of this complex but also physically interacts with and inhibits the activity of neuronal nitric oxide synthase. Binding of this protein destabilizes the neuronal nitric oxide synthase dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity. Alternate transcriptional splice variants have been characterized.
Questions pertaining to this data can be directed to techsupport@avivasysbio.com
Aviva Systems Biology’s DYNLL1 antibody (ARP51350_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.
To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.
All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com
- Protocol:
- Tips Information:
See our General FAQ page.


