DMTF1 Antibody - C-terminal region : FITC (ARP34602_P050-FITC)

Catalog No: ARP34602_P050-FITC

Size:100ul

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: FITC: Fluorescein Isothiocyanate
• Application: IHC, WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DMTF1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
• Peptide Sequence: Synthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DMTF1 (ARP34602_P050-FITC) antibody is Catalog # AAP34602 (Previous Catalog # AAPP23615)

Target Info

• Gene Symbol: DMTF1
• Gene Full Name: cyclin D binding myb like transcription factor 1
• Alias Symbols: DMP1, DMTF, MRUL, hDMP1
• NCBI Gene Id: 9988
• Protein Name: cyclin-D-binding Myb-like transcription factor 1
• Description of Target: This gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q9Y222
• Protein Accession #: EAW76962
• Nucleotide Accession #: NM_001142326
• Protein Size (# AA): 494
• Molecular Weight: 54kDa
• Protein Interactions: SRA1; TP53; ATF7IP; CCND1; CCND3; CCND2;