SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP34602_P050
Price: $0.00
SKU
ARP34602_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-DMTF1 (ARP34602_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human DMTF1
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 92%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%
Peptide SequenceSynthetic peptide located within the following region: SFNDAHVSKFSDQNSTELMNSVMVRTEEEISDTDLKQEESPSDLASAYVT
Concentration0.5 mg/ml
Blocking PeptideFor anti-DMTF1 (ARP34602_P050) antibody is Catalog # AAP34602 (Previous Catalog # AAPP23615)
Publications

Tooth Germ-Like Construct Transplantation for Whole-Tooth Regeneration: An In Vivo Study in the Miniature Pig. Artif Organs. 40, E39-50 (2016). 26582651

Gene SymbolDMTF1
Gene Full Namecyclin D binding myb like transcription factor 1
Alias SymbolsDMP1, DMTF, MRUL, hDMP1
NCBI Gene Id9988
Protein Namecyclin-D-binding Myb-like transcription factor 1
Description of TargetThis gene encodes a transcription factor that contains a cyclin D-binding domain, three central Myb-like repeats, and two flanking acidic transactivation domains at the N- and C-termini. The encoded protein is induced by the oncogenic Ras signaling pathway and functions as a tumor suppressor by activating the transcription of ARF and thus the ARF-p53 pathway to arrest cell growth or induce apoptosis. It also activates the transcription of aminopeptidase N and may play a role in hematopoietic cell differentiation. The transcriptional activity of this protein is regulated by binding of D-cyclins. This gene is hemizygously deleted in approximately 40% of human non-small-cell lung cancer and is a potential prognostic and gene-therapy target for non-small-cell lung cancer. Multiple transcript variants encoding different isoforms have been found for this gene.
Uniprot IDQ9Y222
Protein Accession #EAW76962
Nucleotide Accession #NM_001142326
Protein Size (# AA)494
Molecular Weight54kDa
Protein InteractionsSRA1; TP53; ATF7IP; CCND1; CCND3; CCND2;
  1. What is the species homology for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "DMTF1 Antibody - C-terminal region (ARP34602_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    This target may also be called "DMP1, DMTF, MRUL, hDMP1" in publications.

  5. What is the shipping cost for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "54kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "DMTF1 Antibody - C-terminal region (ARP34602_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "DMTF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "DMTF1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "DMTF1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "DMTF1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "DMTF1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "DMTF1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:DMTF1 Antibody - C-terminal region (ARP34602_P050)
Your Rating
We found other products you might like!