DHX32 Antibody - N-terminal region (ARP36451_P050)

Catalog No: ARP36451_P050

WB Suggested Anti-DHX32 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Lung

Host: Rabbit
Target: DHX32
Positive control (+): MCF7 Cell Lysate (N10)
Negative control (-): Human Brain (BR)
Antibody concentration: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DHX32
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 93%; Rat: 93%
• Peptide Sequence: Synthetic peptide located within the following region: EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DHX32 (ARP36451_P050) antibody is Catalog # AAP36451 (Previous Catalog # AAPP08511)
• Reference: Chen,Y., (2007) Exp. Mol. Pathol. 82 (3), 256-261

Target Info

• Gene Symbol: DHX32
• Gene Full Name: DEAH (Asp-Glu-Ala-His) box polypeptide 32
• Alias Symbols: DDX32, DHLP1
• NCBI Gene Id: 55760
• Protein Name: Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DHX32 is a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates 2 transcript variants, but the full length nature of one of the variants has not been defined.
• Uniprot ID: Q7L7V1
• Protein Accession #: NP_060650
• Nucleotide Accession #: NM_018180
• Protein Size (# AA): 743
• Molecular Weight: 84kDa
• Protein Interactions: FAM161A; UBC;