DDX1 Antibody - N-terminal region (ARP36378_P050)

Catalog No: ARP36378_P050

WB Suggested Anti-DDX1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DDX1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: ILGGGDVLMAAETGSGKTGAFSIPVIQIVYETLKDQQEGKKGKTTIKTGA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-DDX1 (ARP36378_P050) antibody is Catalog # AAP36378 (Previous Catalog # AAPP08436)
• Reference: Defferrari,R., (2007) Cancer Lett. 256 (1), 56-63

Target Info

• Gene Symbol: DDX1
• Gene Full Name: DEAD (Asp-Glu-Ala-Asp) box helicase 1
• Alias Symbols: DBP-RB, UKVH5d
• NCBI Gene Id: 1653
• Protein Name: ATP-dependent RNA helicase DDX1
• Description of Target: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX1 is a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin.DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein of unknown function. It shows high transcription levels in 2 retinoblastoma cell lines and in tissues of neuroectodermal origin. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q92499
• Protein Accession #: NP_004930
• Nucleotide Accession #: NM_004939
• Protein Size (# AA): 740
• Molecular Weight: 82kDa
• Protein Interactions: HUWE1; FUS; SUMO2; SUMO3; STAU1; UBC; SUMO1; NEDD8; Fbxl16; WWOX; ZBTB1; RPA3; RPA2; RPA1; rev; C14orf166; RTCB; RPL26L1; EIF3K; NELFB; EDC4; IGF2BP3; PDCD6; ABCF1; EIF2B2; EIF2B3; YBX3; RPL27; RFC4; RFC2; QARS; YBX1; NMT1; HNRNPM; MRE11A; KRT18; ILF2; HN