website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

CYP2D6 antibody - N-terminal region (ARP41675_T100)

Receive a free blocking peptide (AAP41675) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Gene Symbol:
Official Gene Full Name:
Cytochrome P450, family 2, subfamily D, polypeptide 6
NCBI Gene Id:
Alias Symbols:
RP4-669P10.2; CPD6; CYP2D; CYP2D@; CYP2DL1; MGC120389; MGC120390; P450-DB1; P450C2D; CYPIID6; P450DB1; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2
Tissue Tool:
Find tissues and cell lines supported to express CYP2D6.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Cytochrome P450 2D6
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the N terminal of human CYP2D6
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Protein A purified
Complete computational species homology data:
CYP2D6 antibody - N-terminal region (ARP41675_T100)
Predicted Homology Based on Immunogen Sequence:
Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Zebrafish: 92%; Bovine: 91%; Sheep: 86%; Guinea pig: 86%; Dog: 79%
Species Reactivity:
Human, Rat, Horse, Pig, Rabbit, Mouse, Zebrafish, Bovine, Sheep, Guinea pig, Dog
Datasheets / Downloads:
Printable datasheet for
anti-CYP2D6 antibody
- ARP41675_T100
Peptide Sequence:
Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE
Blocking Peptide:
For anti-CYP2D6 antibody is Catalog # AAP41675 (Previous Catalog # AAPP24318)
Target Reference:
Rowland,P., (2006) J. Biol. Chem. 281 (11), 7614-7622
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for CYP2D6 antibody (ARP41675)

Product page for CYP2D6 antibody (ARP41675)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100655392 antibody; Loxodonta africana LOC100655392 antibody G3TZV8 85%
African elephant LOC100656155 antibody; Loxodonta africana LOC100656155 antibody G3UBC9 85%
Amur leopard cat CYP2D6 antibody; Prionailurus bengalensis euptilurus CYP2D6 antibody E3VVX3 91%
Amur leopard cat CYP2D6 antibody; Prionailurus bengalensis euptilurus CYP2D6 antibody E3VVX2 91%
Bobcat CYP2D6 antibody; Lynx rufus CYP2D6 antibody E3VVX0 91%
Bobcat CYP2D6 antibody; Lynx rufus CYP2D6 antibody E3VVW9 91%
Bobcat CYP2D6 antibody; Lynx rufus CYP2D6 antibody E3VVW8 91%
Bovine CP2DE antibody; Bos taurus CP2DE antibody Q01361 78%
Bovine CYP2D14 antibody; Bos taurus CYP2D14 antibody G1K127 78%
Bovine MGC127055 antibody; Bos taurus MGC127055 antibody Q2KJJ2 85%
Cat CYP2D6 antibody; Felis catus CYP2D6 antibody E0D568 91%
Cheetah CYP2D6 antibody; Acinonyx jubatus CYP2D6 antibody E3VVW3 91%
Cheetah CYP2D6 antibody; Acinonyx jubatus CYP2D6 antibody E3VVW1 91%
Cheetah CYP2D6 antibody; Acinonyx jubatus CYP2D6 antibody E3VVW0 91%
Chimpanzee CP2D6 antibody; Pan troglodytes CP2D6 antibody Q2XNC8 100%
Chimpanzee CYP2D7 antibody; Pan troglodytes CYP2D7 antibody F2Z8A5 100%
Crab-eating macaque CP2DH antibody; Macaca fascicularis CP2DH antibody Q29488 100%
Crab-eating macaque CYP2D17 antibody; Macaca fascicularis CYP2D17 antibody D9DB13 100%
Crab-eating macaque CYP2D44 antibody; Macaca fascicularis CYP2D44 antibody D8KWQ4 100%
Florida puma CYP2D6 antibody; Puma concolor coryi CYP2D6 antibody E3VVX5 91%
Golden hamster CP2DS antibody; Mesocricetus auratus CP2DS antibody Q9QUJ1 100%
Gray short-tailed opossum CYP2D6 antibody; Monodelphis domestica CYP2D6 antibody F6ZAY4 78%
Guinea pig CP2DG antibody; Cavia porcellus CP2DG antibody Q64403 85%
Guinea pig CYP2D16 antibody; Cavia porcellus CYP2D16 antibody H0W1H6 85%
Guinea pig LOC100715321 antibody; Cavia porcellus LOC100715321 antibody H0WBE1 85%
Guinea pig LOC100715321 antibody; Cavia porcellus LOC100715321 antibody H0UWX6 85%
Guinea pig LOC100716545 antibody; Cavia porcellus LOC100716545 antibody H0WB02 85%
Guinea pig LOC100719511 antibody; Cavia porcellus LOC100719511 antibody H0UXB7 85%
Horse CYP2D50 antibody; Equus caballus CYP2D50 antibody F6VQ67 92%
Horse CYP2D50 antibody; Equus caballus CYP2D50 antibody A8W4X2 92%
Horse LOC100056087 antibody; Equus caballus LOC100056087 antibody F6YT02 92%
Horse LOC100070895 antibody; Equus caballus LOC100070895 antibody F6TYD5 85%
Human CP2D6 antibody; Homo sapiens CP2D6 antibody P10635 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody Q6NWU0 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody Q59FG8 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody Q3KPF3 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody Q38LG2 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody Q38LG0 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody Q2XND3 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody Q2XND2 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody Q2XND0 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody Q16804 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody H0Y7Q0 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody G9CGD2 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody E7ENE7 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KND2 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KNB5 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KN64 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KN61 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KN50 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KN10 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KN01 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KMZ1 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KMU5 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KMS0 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KMR1 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KMQ2 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D0U5L8 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody C1ID54 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody C1ID52 100%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody Q2XND8 92%
Human CYP2D6 antibody; Homo sapiens CYP2D6 antibody D5KMU6 92%
Human CYP2D7P1 antibody; Homo sapiens CYP2D7P1 antibody Q6XP50 100%
Leopard cat CYP2D6 antibody; Prionailurus bengalensis CYP2D6 antibody E3VVX1 91%
Lion CYP2D6 antibody; Panthera leo CYP2D6 antibody E3VVX7 91%
Lowland gorilla CYP2D6 antibody; Gorilla gorilla gorilla CYP2D6 antibody G3RRD9 100%
Lowland gorilla CYP2D6 antibody; Gorilla gorilla gorilla CYP2D6 antibody G3QDX1 100%
Mountain lion CYP2D6 antibody; Puma concolor CYP2D6 antibody E3VVX6 91%
Mountain lion CYP2D6 antibody; Puma concolor CYP2D6 antibody E3VVX4 91%
Mouse CP2D9 antibody; Mus musculus CP2D9 antibody P11714 92%
Mouse CP2DA antibody; Mus musculus CP2DA antibody P24456 92%
Mouse CP2DB antibody; Mus musculus CP2DB antibody P24457 92%
Mouse CP2DQ antibody; Mus musculus CP2DQ antibody Q8CIM7 85%
Mouse Cyp2d10 antibody; Mus musculus Cyp2d10 antibody D3Z5T9 92%
Mouse Cyp2d11 antibody; Mus musculus Cyp2d11 antibody E9QLB0 92%
Mouse Cyp2d11 antibody; Mus musculus Cyp2d11 antibody E9Q750 92%
Mouse Cyp2d34 antibody; Mus musculus Cyp2d34 antibody D3Z5Z8 92%
Mouse Cyp2d34 antibody; Mus musculus Cyp2d34 antibody D3Z5X1 92%
Mouse Cyp2d9 antibody; Mus musculus Cyp2d9 antibody Q3UNW2 92%
Northern white-cheeked gibbon CYP2D6 antibody; Nomascus leucogenys CYP2D6 antibody G1S165 100%
Northern white-cheeked gibbon CYP2D6 antibody; Nomascus leucogenys CYP2D6 antibody G1S141 92%
Pig CP2DP antibody; Sus scrofa CP2DP antibody O46658 92%
Pig CYP2D6 antibody; Sus scrofa CYP2D6 antibody F1SRG4 92%
Pig CYP2D6 antibody; Sus scrofa CYP2D6 antibody F1SRG3 92%
Pygmy chimpanzee CP2D6 antibody; Pan paniscus CP2D6 antibody Q2XNC9 100%
Rabbit CYP2D23 antibody; Oryctolagus cuniculus CYP2D23 antibody Q9TUJ5 85%
Rabbit CYP2D24 antibody; Oryctolagus cuniculus CYP2D24 antibody Q9TUJ4 92%
Rabbit LOC100348527 antibody; Oryctolagus cuniculus LOC100348527 antibody G1TMZ7 92%
Rat CP2D3 antibody; Rattus norvegicus CP2D3 antibody P12938 85%
Rat CP2DQ antibody; Rattus norvegicus CP2DQ antibody P10634 78%
Rat Cyp2d3 antibody; Rattus norvegicus Cyp2d3 antibody F1LMN4 85%
Rhesus macaque CYP2D6 antibody; Macaca mulatta CYP2D6 antibody Q6GUQ5 100%
Rhesus macaque LOC100424965 antibody; Macaca mulatta LOC100424965 antibody F7H4W8 100% d>
Rhesus macaque Mmu.3776 antibody; Macaca mulatta Mmu.3776 antibody F7DTR7 100%
Sheep CYP2D6 antibody; Ovis aries CYP2D6 antibody F1CGV1 85%
Siberian tiger CYP2D6 antibody; Panthera tigris altaica CYP2D6 antibody E3VVY1 91%
Siberian tiger CYP2D6 antibody; Panthera tigris altaica CYP2D6 antibody E3VVY0 91%
Western Mediterranean mouse Cyp2d9 antibody; Mus spretus Cyp2d9 antibody Q64529 92%
White-tufted-ear marmoset CP2DJ antibody; Callithrix jacchus CP2DJ antibody O18992 100%
Zebrafish cyp2p6 antibody; Danio rerio cyp2p6 antibody Q803J0 91%
Zebrafish cyp2p6 antibody; Danio rerio cyp2p6 antibody Q5TZ76 91%
Zebrafish cyp2p6 antibody; Danio rerio cyp2p6 antibody E7FDA7 91%
Zebrafish cyp2p8 antibody; Danio rerio cyp2p8 antibody Q5TZ86 91%
Zebrafish cyp2p9 antibody; Danio rerio cyp2p9 antibody Q6PGV7 91%
Zebrafish cyp2p9 antibody; Danio rerio cyp2p9 antibody Q5TZ85 91%
Zebrafish cyp2p9 antibody; Danio rerio cyp2p9 antibody E7FEJ8 91%
Zebrafish OTTDARG00000005504 antibody; Danio rerio OTTDARG00000005504 antibody E7EZ45 91%

Product Protocols: CYP2D6 antibody tested with Human Fetal Liver Tissue (ARP41675_T100)

Aviva Systems Biology is the original manufacturer of this CYP2D6 antibody (ARP41675_T100)

Click here to view the CYP2D6 antibody Western Blot Protocol

Product Datasheet Link: CYP2D6 antibody (ARP41675_T100)

WB Suggested Anti-CYP2D6 Antibody Titration: 2.5ug/ml
Positive Control: Fetal Liver

Western Blot image:

Description of Target: CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CYP2D6 antibody (ARP41675_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: CYP2D6 antibody tested by IHC with human kidney (ARP41675)

Aviva Systems Biology is the original manufacturer of this CYP2D6 antibody.

Click here to view the CYP2D6 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: CYP2D6 antibody (ARP41675)

IHC Information:

Rabbit Anti-CYP2D6 Antibody
Catalog Number: ARP41675
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question