website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

CYP2D6 antibody - N-terminal region (ARP41675_T100)

Receive a free blocking peptide (AAP41675) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Gene Symbol:
Official Gene Full Name:
Cytochrome P450, family 2, subfamily D, polypeptide 6
NCBI Gene Id:
Alias Symbols:
RP4-669P10.2; CPD6; CYP2D; CYP2D@; CYP2DL1; MGC120389; MGC120390; P450-DB1; P450C2D; CYPIID6; P450DB1; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2
Tissue Tool:
Find tissues and cell lines supported to express CYP2D6.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Cytochrome P450 2D6
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-CYP2D6 antibody: synthetic peptide directed towards the N terminal of human CYP2D6
Product Format:
Lyophilized powder
Protein A purified
Complete computational species homology data:
CYP2D6 antibody - N-terminal region (ARP41675_T100)
Predicted Homology Based on Immunogen Sequence:
Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Mouse: 93%; Rabbit: 93%; Zebrafish: 92%; Bovine: 91%; Sheep: 86%; Guinea pig: 86%; Dog: 79%
Species Reactivity:
Human, Rat, Horse, Pig, Rabbit, Mouse, Zebrafish, Bovine, Sheep, Guinea pig, Dog
Datasheets / Downloads:
Printable datasheet for
anti-CYP2D6 antibody
- ARP41675_T100
Peptide Sequence:
Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE
Blocking Peptide:
For anti-CYP2D6 antibody is Catalog # AAP41675 (Previous Catalog # AAPP24318)
Key Reference:
Rowland,P., (2006) J. Biol. Chem. 281 (11), 7614-7622
Reconstitution and Storage:
Add 100 ul of distilled water. Final anti-CYP2D6 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question