website statistics
Account Login 

Aviva Systems Biology office will be closed for Labor Day - 9/7/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

CYP2D6 antibody - N-terminal region (ARP41675_T100)

Receive a free blocking peptide (AAP41675) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Gene Symbol:
Official Gene Full Name:
Cytochrome P450, family 2, subfamily D, polypeptide 6
NCBI Gene Id:
Alias Symbols:
RP4-669P10.2; CPD6; CYP2D; CYP2D@; CYP2DL1; MGC120389; MGC120390; P450-DB1; P450C2D; CYPIID6; P450DB1; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CYP2D6.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CYP2D6.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
Cytochrome P450 2D6
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the N terminal region of human CYP2D6
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein A purified
Complete computational species homology data:
Anti-CYP2D6 (ARP41675_T100)
Predicted Homology Based on Immunogen Sequence:
Cow: 91%; Dog: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 100%; Sheep: 86%; Zebrafish: 92%
Species Reactivity:
Cow; Dog; Guinea Pig; Horse; Human; Mouse; Pig; Rabbit; Rat; Sheep; Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-CYP2D6 (ARP41675_T100) antibody
Peptide Sequence:
Synthetic peptide located within the following region: RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE
Blocking Peptide:
For anti-CYP2D6 (ARP41675_T100) antibody is Catalog # AAP41675 (Previous Catalog # AAPP24318)
Target Reference:
Rowland,P., (2006) J. Biol. Chem. 281 (11), 7614-7622
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: CYP2D6 antibody tested with Human Fetal Liver Tissue (ARP41675_T100)

Aviva Systems Biology is the original manufacturer of this CYP2D6 antibody (ARP41675_T100)

Click here to view the CYP2D6 antibody Western Blot Protocol

Product Datasheet Link: CYP2D6 antibody (ARP41675_T100)

WB Suggested Anti-CYP2D6 Antibody Titration: 2.5ug/ml
Positive Control: Fetal Liver

Western Blot image:

Description of Target: CYP2D6 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 20% of commonly prescribed drugs. Its substrates include debrisoquine, an adrenergic-blocking drug; sparteine and propafenone, both anti-arrythmic drugs; and amitryptiline, an anti-depressant. The gene is highly polymorphic in the population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. The gene is located near two cytochrome P450 pseudogenes on chromosome 22q13.1. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CYP2D6 antibody (ARP41675_T100) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocols: CYP2D6 antibody tested by IHC with human kidney (ARP41675)

Aviva Systems Biology is the original manufacturer of this CYP2D6 antibody.

Click here to view the CYP2D6 antibody Immunohistochemistry (IHC) protocol

Product Datasheet Link: CYP2D6 antibody (ARP41675)

IHC Information:

Rabbit Anti-CYP2D6 Antibody
Catalog Number: ARP41675
Paraffin Embedded Tissue: Human Kidney
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 ug/ml
Magnification: 400X

IHC Image:

Ask a Question