SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP36128_P050
Price: $0.00
SKU
ARP36128_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CTCFL (ARP36128_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CTCFL
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%
Peptide SequenceSynthetic peptide located within the following region: CREKDHRSPSELEAERTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTV
Concentration0.5 mg/ml
Blocking PeptideFor anti-CTCFL (ARP36128_P050) antibody is Catalog # AAP36128 (Previous Catalog # AAPP07456)
Sample Type Confirmation

CTCFL is supported by BioGPS gene expression data to be expressed in 721_B

ReferenceSun,L., (2008) Cancer Res. 68 (8), 2726-2735
Gene SymbolCTCFL
Gene Full NameCCCTC-binding factor (zinc finger protein)-like
Alias SymbolsCT27, BORIS, CTCF-T, HMGB1L1, dJ579F20.2
NCBI Gene Id140690
Protein NameTranscriptional repressor CTCFL
Description of TargetCCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. CTCFL is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes, unlike CTCF which is expressed primarily in the nucleus of somatic cells. CTCF and CTCFL are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation.CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. This gene is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes, unlike CTCF which is expressed primarily in the nucleus of somatic cells. CTCF and the protein encoded by this gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ8NI51
Protein Accession #NP_542185
Nucleotide Accession #NM_080618
Protein Size (# AA)663
Molecular Weight76kDa
Protein InteractionsSP1; BAG6; HIST2H2AC; HIST1H1A; PRMT7; HIST1H3A; BRCA1;
  1. What is the species homology for "CTCFL Antibody - N-terminal region (ARP36128_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "CTCFL Antibody - N-terminal region (ARP36128_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CTCFL Antibody - N-terminal region (ARP36128_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CTCFL Antibody - N-terminal region (ARP36128_P050)"?

    This target may also be called "CT27, BORIS, CTCF-T, HMGB1L1, dJ579F20.2" in publications.

  5. What is the shipping cost for "CTCFL Antibody - N-terminal region (ARP36128_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CTCFL Antibody - N-terminal region (ARP36128_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CTCFL Antibody - N-terminal region (ARP36128_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "76kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CTCFL Antibody - N-terminal region (ARP36128_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CTCFL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CTCFL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CTCFL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CTCFL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CTCFL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CTCFL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CTCFL Antibody - N-terminal region (ARP36128_P050)
Your Rating
We found other products you might like!