CSTF3 Antibody - middle region (ARP40353_P050)

Catalog No: ARP40353_P050

WB Suggested Anti-CSTF3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateCSTF3 is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CSTF3
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FEELKKHEDSAIPRRLECLKEDVQRQQEREKELQHRYADLLLEKETLKSK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CSTF3 (ARP40353_P050) antibody is Catalog # AAP40353 (Previous Catalog # AAPP10390)
• Sample Type Confirmation:

  CSTF3 is supported by BioGPS gene expression data to be expressed in 721_B

• Subunit: 3
• Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Target Info

• Gene Symbol: CSTF3
• Gene Full Name: Cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
• Alias Symbols: CSTF-77
• NCBI Gene Id: 1479
• Protein Name: Cleavage stimulation factor subunit 3
• Description of Target: CSTF3 is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. The protein encoded by this gene is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The encoded protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex. Alternative splicing results in multiple transcript variants encoding different isoforms.
• Uniprot ID: Q12996
• Protein Accession #: NP_001317
• Nucleotide Accession #: NM_001326
• Protein Size (# AA): 717
• Molecular Weight: 83kDa
• Protein Interactions: RBBP6; UBC; WWOX; rev; HECW2; POLR2A; WHSC1; CSTF1; CSTF2T; GAPDH; CSTF2; CUL3; HNRNPA1; CPSF1; RRAGA; CDC73; VHL; E2F4; ASF1;