CRLF2 Antibody - middle region (ARP44624_P050)

Catalog No: ARP44624_P050

WB Suggested Anti-CRLF2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CRLF2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: FWVRVKAMEDVYGPDTYPSDWSEVTCWQRGEIRDACAETPTPPKPKLSKF
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CRLF2 (ARP44624_P050) antibody is Catalog # AAP44624 (Previous Catalog # AAPP12103)

Target Info

• Gene Symbol: CRLF2
• Gene Full Name: Cytokine receptor-like factor 2
• Alias Symbols: CRL2, TSLPR, CRLF2Y
• NCBI Gene Id: 64109
• Protein Name: Thymic stromal-derived lymphopoietin receptor transcript variant 2 EMBL AAW66851.1
• Description of Target: Cytokine signals are mediated through specific receptor complexes, the components of which are mostly members of the type I cytokine receptor family. Type I cytokine receptors share conserved structural features in their extracellular domain. Receptor complexes are typically heterodimeric, consisting of alpha chains, which provide ligand specificity, and beta (or gamma) chains, which are required for the formation of high-affinity binding sites and signal transduction.
• Uniprot ID: Q5G7M1
• Protein Accession #: NP_001012288
• Nucleotide Accession #: NM_001012288
• Protein Size (# AA): 259
• Molecular Weight: 29kDa
• Protein Interactions: TSLP; JAK2; IL7R;