CRBN Antibody - N-terminal region (ARP56882_P050)

Catalog No: ARP56882_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Host: Rabbit
Target Name: CRBN
Sample Tissue: Human Ovary Tumor
Antibody Dilution: 1ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CRBN
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CRBN (ARP56882_P050) antibody is Catalog # AAP56882 (Previous Catalog # AAPP39828)
• Enhanced Validation:

  Relative Expression (Western Blot)

• Reference: 0
• Publications:

  HDAC6‑selective inhibitor synergistically enhances the anticancer activity of immunomodulatory drugs in multiple myeloma. Int J Oncol. 55, 499-512 (2019). 31268156

  Measuring cereblon as a biomarker of response or resistance to lenalidomide and pomalidomide requires use of standardized reagents and understanding of gene complexity. Br J Haematol. 164, 233-44 (2014). 24206017

• Description:
  View product citations for CRBN Antibody - N-terminal region (ARP56882_P050) on CiteAb

Target Info

• Gene Symbol: CRBN
• Gene Full Name: Cereblon
• Alias Symbols: MRT2, MRT2A
• NCBI Gene Id: 51185
• Protein Name: Protein cereblon
• Description of Target: This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development. Mutatio
• Uniprot ID: Q96SW2
• Protein Accession #: NP_057386
• Nucleotide Accession #: NM_016302
• Protein Size (# AA): 442
• Molecular Weight: 50 kDa
• Protein Interactions: PAK7; RBPMS; MEIS2; DDB1; IKZF3; IKZF1; SUV39H1; KDM1A; UBC; COPS4; COPS6; COPS3; PSMB4; PSMA2; COPS5; CUL4A; PRKAA1; RBX1;