CPNE4 Antibody - N-terminal region (ARP52543_P050)

Catalog No: ARP52543_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-CPNE4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: OVCAR-3 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CPNE4
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
• Peptide Sequence: Synthetic peptide located within the following region: EADFLGGMECTLGQIVSQRKLSKSLLKHGNTAGKSSITVIAEELSGNDDY
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CPNE4 (ARP52543_P050) antibody is Catalog # AAP52543 (Previous Catalog # AAPS32108)
• Reference: Maitra,R., (2003) Biochem. Biophys. Res. Commun. 303 (3), 842-847

Target Info

• Gene Symbol: CPNE4
• Gene Full Name: Copine IV
• Alias Symbols: CPN4, COPN4
• NCBI Gene Id: 131034
• Protein Name: Copine-4
• Description of Target: Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus.
• Uniprot ID: Q96A23
• Protein Accession #: NP_570720
• Nucleotide Accession #: NM_130808
• Protein Size (# AA): 557
• Molecular Weight: 62kDa
• Protein Interactions: UBE2O; CEP162; MYCBP; PITPNM2; CCDC22; BCOR; CPNE1; UBE2M; BICD1; PDCD6; PPP5C; SPTBN1; RDX; MAP2K1; SKIL; ACTB; Cdc42bpb; Etl4; Cenpf; Mycbp2; Bicd2; Alg2; Nono;