SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP41186_P050
Price: $0.00
SKU
ARP41186_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CPEB2 (ARP41186_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Guinea Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CPEB2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceGuinea Pig: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CPEB2 (ARP41186_P050) antibody is Catalog # AAP41186 (Previous Catalog # AAPP22561)
ReferenceKurihara,Y., (2003) Biol. Reprod. 69 (1), 261-268
Publications

CPEB2 Is Necessary for Proper Porcine Meiotic Maturation and Embryonic Development. Int J Mol Sci. 19, (2018). 30322039

Description
Gene SymbolCPEB2
Gene Full NameCytoplasmic polyadenylation element binding protein 2
Alias SymbolsCPEB-2, CPE-BP2, hCPEB-2
NCBI Gene Id132864
Protein NameCytoplasmic polyadenylation element-binding protein 2
Description of TargetCPEB2 is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids.The protein encoded by this gene is highly similar to cytoplasmic polyadenylation element binding protein (CPEB), an mRNA-binding protein that regulates cytoplasmic polyadenylation of mRNA as a trans factor in oogenesis and spermatogenesis. Studies of the similar gene in mice suggested a possible role of this protein in transcriptionally inactive haploid spermatids. Alternatively spliced transcript variants encoding distinct isoforms have been described.
Uniprot IDQ7Z5Q1-2
Protein Accession #NP_872291
Nucleotide Accession #NM_182485
Protein Size (# AA)589
Molecular Weight65kDa
  1. What is the species homology for "CPEB2 Antibody - N-terminal region (ARP41186_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Guinea Pig".

  2. How long will it take to receive "CPEB2 Antibody - N-terminal region (ARP41186_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CPEB2 Antibody - N-terminal region (ARP41186_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CPEB2 Antibody - N-terminal region (ARP41186_P050)"?

    This target may also be called "CPEB-2, CPE-BP2, hCPEB-2" in publications.

  5. What is the shipping cost for "CPEB2 Antibody - N-terminal region (ARP41186_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CPEB2 Antibody - N-terminal region (ARP41186_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CPEB2 Antibody - N-terminal region (ARP41186_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "65kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CPEB2 Antibody - N-terminal region (ARP41186_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CPEB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CPEB2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CPEB2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CPEB2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CPEB2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CPEB2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CPEB2 Antibody - N-terminal region (ARP41186_P050)
Your Rating
We found other products you might like!