Home > Products >  Western Blot Kits

ARIH2 Western Blot Kit


Preview
Catalog#   Accession # Size Price Qty
ARPK34418_T100   NP_006312 1 Kit $549.00
Description: 
The ARIH2 Western Blot Kit provides all the reagents that are required for conducting high quality western blot analysis. Conditions and protocols have been optimized for easy visualization of the ARIH2 protein target. Primary Target-Specific Antibody and Secondary HRP Conjugated Antibody are included to facilitate rapid detection of the target protein. The enclosed Positive Control Cell Lysate can be included in the western blot procedure in order to ensure that the antibody is functioning properly and successfully detecting the target protein. The peptide used to generate the primary antibody has also been enclosed to facilitate Peptide Blocking studies to confirm the specificity of the Primary Antibodies binding affinity.
# Western Blots / Kit: 
25  
Species Reactivity: 
Human  
Primary Antibody: 
100µg ARIH2, Catalog# ARP34418_T100, Rabbit Polyclone, Protein A purifed, Predict MW 58kDa  
Secondary Antibody: 
4µg HRP Conjµgated Goat Anti-Rabbit IgG(AViHRP-GAR)  
Positive Control Lysate: 
625µg Jurkat Cell Lysate (AHL002)  
Blocking Peptide: 
100µg ARIH2 Peptide(P23502)  
50AA Region Containing 14AA Immunogen: 
IEDYYVGVASDVEQQGADAFDPEEYQFTCLTYKESEGALNEHMTSLASVL  
Reconstitution and Storage: 
Primary Antibody 50µl dd H2O, Secondary Antibody 50µl dd H2O, Cell Lysate 125µl dd H2O, Peptide 100µl dd H2O. Working stock 4°, Long Term Storage -20° Aliquoted  
Instructions: 
Western Blot Kit Instruction Manual  
Western Blot Protocol: 
Western Blot Protocol  
Peptide Blocking Protocol: 
Western Blot Peptide Competition Assay Protocol  
Peptide Datasheet: 
P23502 Peptide Immunogen Data Sheet.pdf  
Immunoblot

ARP34418-QC11439-WB.jpg