PCBP1 Western Blot Kit
Cat. No. ARPK40630_T100
 

The PCBP1 Western Blot Kit provides all the reagents that are required for conducting high quality western blot analysis. Conditions and protocols have been optimized for easy visualization of the PCBP1 protein target. Primary Target-Specific Antibody and Secondary HRP Conjugated Antibody are included to facilitate rapid detection of the target protein. The enclosed Positive Control Cell Lysate can be included in the western blot procedure in order to ensure that the antibody is functioning properly and successfully detecting the target protein. The peptide used to generate the primary antibody has also been enclosed to facilitate Peptide Blocking studies to confirm the specificity of the Primary Antibodies binding affinity.

 
  # Western Blots / Kit 25  
  Species Reactivity Human  
  Primary Antibody 100µg PCBP1, Catalog# ARP40630_T100, Rabbit Polyclone, Protein A purifed, Predict MW 39kDa  
  Secondary Antibody 4µg HRP Conjµgated Goat Anti-Rabbit IgG(AViHRP-GAR)  
  Positive Control Lysate 625µg HepG2 Cell Lysate (AHL001)  
  Blocking Peptide 100µg PCBP1 Peptide(P10617)  
  50AA Region Containing 14AA Immunogen TIPYQPMPASSPVICAGGQDRCSDAVGYPHATHDLEGPPLDAYSIQGQHT  
  Reconstitution and Storage Primary Antibody 100µl dd H2O, Secondary Antibody 50µl dd H2O, Cell Lysate 125µl dd H2O, Peptide 100µl dd H2O. Working stock 4°, Long Term Storage -20° Aliquoted  
   
   
  Our Price: $549.00  
  Order Online