COG2 Antibody - N-terminal region (ARP54815_P050)

Catalog No: ARP54815_P050

WB Suggested Anti-COG2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysateCOG2 is supported by BioGPS gene expression data to be expressed in HepG2

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human COG2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 77%
• Peptide Sequence: Synthetic peptide located within the following region: KRVQLEELRDDLELYYKLLKTAMVELINKDYADFVNLSTNLVGMDKALNQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-COG2 (ARP54815_P050) antibody is Catalog # AAP54815 (Previous Catalog # AAPP31619)
• Sample Type Confirmation:

  COG2 is supported by BioGPS gene expression data to be expressed in HepG2

• Subunit: 2
• Reference: Sohda,M., (2007) Traffic 8 (3), 270-284

Target Info

• Gene Symbol: COG2
• Gene Full Name: Component of oligomeric golgi complex 2
• Alias Symbols: LDLC, CDG2Q
• NCBI Gene Id: 22796
• Protein Name: Conserved oligomeric Golgi complex subunit 2
• Description of Target: Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG2. Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG2 (Ungar et al., 2002 [PubMed 11980916]).[supplied by OMIM].
• Uniprot ID: Q14746
• Protein Accession #: NP_031383
• Nucleotide Accession #: NM_007357
• Protein Size (# AA): 738
• Molecular Weight: 83kDa
• Protein Interactions: MTUS2; UBC; COG7; COG8; COG3; COG6; COG5; COG1; COG4;