CMTM8 Antibody - middle region (ARP53386_P050)

Catalog No: ARP53386_P050

WB Suggested Anti-CMTM8 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CMTM8
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CMTM8 (ARP53386_P050) antibody is Catalog # AAP53386 (Previous Catalog # AAPP30969)
• Reference: Jin,C., (2007) J. Cell. Physiol. 211 (1), 112-120

Target Info

• Gene Symbol: CMTM8
• Gene Full Name: CKLF-like MARVEL transmembrane domain containing 8
• Alias Symbols: CKLFSF8, CKLFSF8-V2
• NCBI Gene Id: 152189
• Protein Name: CKLF-like MARVEL transmembrane domain-containing protein 8
• Description of Target: Cmtm8 gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.
• Uniprot ID: Q8IZV2
• Protein Accession #: NP_849199
• Nucleotide Accession #: NM_178868
• Protein Size (# AA): 173
• Molecular Weight: 19kDa
• Protein Interactions: EGFR;