CLEC4M Antibody (OAAL00512)

Catalog No: OAAL00512

Size:100UG

Western Blot analysis of CLEC4M expression in transfected 293T cell line by CLEC4M monoclonal antibody (M01), clone 2G1.
Lane 1: CLEC4M transfected lysate (Predicted MW: 12.21 KDa).
Lane 2: Non-transfected lysate.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 2G1
• Isotype: IgG3 Lambda
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: CLEC4M (NP_055072, 285 a.a. ~ 394 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: SQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAA
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: CLEC4M
• Gene Full Name: C-type lectin domain family 4 member M
• Alias Symbols: CD209 antigen-like protein 1;CD209L;CD299;CD299 antigen;C-type lectin domain family 4 member M;DC-SIGN2;DCSIGNR;DC-SIGNR;DC-SIGN-related protein;dendritic cell-specific ICAM-3-grabbing non-integrin 2;HP10347;liver/lymph node-specific ICAM-3 grabbing non-integrin;LSIGN;L-SIGN;mannose binding C-type lectin DC-SIGNR.
• NCBI Gene Id: 10332
• Protein Name: C-type lectin domain family 4 member M isoform 1 [Homo sapiens]|Homo sapiens C-type lectin domain family 4 member M (CLEC4M), transcript variant 1, mRNA
• Description of Target: This gene encodes a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/NP_055072
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/NM_014257