CLEC14A Antibody - C-terminal region (ARP68222_P050)

Catalog No: ARP68222_P050

Host: Rabbit
Target Name: CLEC14A
Sample Type: Fetal Brain lysates
Antibody Dilution: 0.25ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CLEC14A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 93%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SQPRKESMGPPGLESDPEPAALGSSSAHCTNNGVKVGDCDLRDRAEGALL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CLEC14A (ARP68222_P050) antibody is Catalog # AAP68222

Target Info

• Gene Symbol: CLEC14A
• Alias Symbols: CEG1, EGFR-5, C14orf27
• NCBI Gene Id: 161198
• Protein Name: C-type lectin domain family 14 member A
• Description of Target: This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This family member plays a role in cell-cell adhesion and angiogenesis. It functions in filopodia formation, cell migration and tube formation. Due to its presence at higher levels in tumor endothelium than in normal tissue endothelium, it is considered to be a candidate for tumor vascular targeting.
• Uniprot ID: Q86T13
• Protein Accession #: NP_778230
• Nucleotide Accession #: NM_175060
• Protein Size (# AA): 490
• Molecular Weight: 54kDa