CHAC1 Antibody - C-terminal region (ARP42623_P050)

Catalog No: ARP42623_P050

WB Suggested Anti-CHAC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysateCHAC1 is supported by BioGPS gene expression data to be expressed in 721_B

Host: Rabbit
Target Name: CHAC1
Sample Tissue: Human H69 Whole Cell
Antibody Dilution: 5ug/ml

Host: Rabbit
Target: CHAC1
Positive control (+): MCF7 (N10)
Negative control (-): Human liver (LI)
Antibody concentration: 0.5ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CHAC1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TPQNPGYLGPAPEEAIATQILACRGFSGHNLEYLLRLADFMQLCGPQAQD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CHAC1 (ARP42623_P050) antibody is Catalog # AAP42623 (Previous Catalog # AAPP24858)
• Sample Type Confirmation:

  CHAC1 is supported by BioGPS gene expression data to be expressed in 721_B

• Enhanced Validation:

  WB	Y
  SPR
  YCHAROS

• Reference: Gerhard,D.S., Genome Res. 14 (10B), 2121-2127 (2004)

Target Info

• Gene Symbol: CHAC1
• Gene Full Name: ChaC, cation transport regulator homolog 1 (E. coli)
• Alias Symbols: MGC4504
• NCBI Gene Id: 79094
• Protein Name: Cation transport regulator-like protein 1
• Description of Target: CHAC1 belongs to the chaC family. The exact function of CHAC1 remains unknown.
• Uniprot ID: Q9BUX1
• Protein Accession #: NP_077016
• Nucleotide Accession #: NM_024111
• Protein Size (# AA): 222
• Molecular Weight: 24 kDa
• Protein Interactions: UBC; RHOXF2;