SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP49096_P050
Price: $0.00
SKU
ARP49096_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CDYL (ARP49096_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the n terminal region of human CDYL
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 79%; Rabbit: 93%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: YIHDFNRRHTEKQKESTLTRTNRTSPNNARKQISRSTNSNFSKTSPKALV
Concentration0.5 mg/ml
Blocking PeptideFor anti-CDYL (ARP49096_P050) antibody is Catalog # AAP49096 (Previous Catalog # AAPY02282)
ReferenceNousiainen,M., (2006) Proc. Natl. Acad. Sci. U.S.A. 103 (14), 5391-5396
Publications

Li, J. et al. A strategy to rapidly identify the functional targets of microRNAs by combining bioinformatics and mRNA cytoplasmic/nucleic ratios in culture cells. FEBS Lett. 584, 3198-202 (2010). 20547158

Gene SymbolCDYL
Gene Full NameChromodomain protein, Y-like
Alias SymbolsCDYL1
NCBI Gene Id9425
Protein NameChromodomain Y-like protein
Description of TargetCDYL acts as repressor of transcription. CDYL has histone acetyltransferase activity, with a preference for histone H4.Chromodomain Y is a primate-specific Y-chromosomal gene family expressed exclusively in the testis and implicated in infertility. Although the Y-linked genes are testis-specific, this autosomal gene is ubiquitously expressed. The Y-linked genes arose by retrotransposition of an mRNA from this gene, followed by amplification of the retroposed gene. Proteins encoded by this gene superfamily possess a chromodomain, a motif implicated in chromatin binding and gene suppression, and a catalytic domain believed to be involved in histone acetylation. Multiple proteins are encoded by transcript variants of this gene.
Uniprot IDQ9Y232
Protein Accession #NP_004815
Nucleotide Accession #NM_004824
Protein Size (# AA)544
Molecular Weight60kDa
Protein InteractionsUBC; HECW2; HDAC2; HDAC1; MIER1; MIER2; EHMT2; RBBP4; MYC; SUZ12; EZH2; CTBP1; WIZ; ZNF644; SETDB1; SMARCB1; SMARCA4; REST; HIST1H3A; HTRA1;
  1. What is the species homology for "CDYL Antibody - N-terminal region (ARP49096_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "CDYL Antibody - N-terminal region (ARP49096_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CDYL Antibody - N-terminal region (ARP49096_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CDYL Antibody - N-terminal region (ARP49096_P050)"?

    This target may also be called "CDYL1" in publications.

  5. What is the shipping cost for "CDYL Antibody - N-terminal region (ARP49096_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CDYL Antibody - N-terminal region (ARP49096_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CDYL Antibody - N-terminal region (ARP49096_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "60kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CDYL Antibody - N-terminal region (ARP49096_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CDYL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CDYL"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CDYL"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CDYL"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CDYL"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CDYL"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CDYL Antibody - N-terminal region (ARP49096_P050)
Your Rating