CDH26 Antibody - middle region (ARP67448_P050)

Catalog No: ARP67448_P050

Host: Rabbit
Target Name: CDH26
Sample Type: COLO205 Whole Cell lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human CDH26
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VQVTDANDPPAFHPQSFIVNKEEGARPGTLLGTFNAMDPDSQIRYELVHD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CDH26 (ARP67448_P050) antibody is Catalog # AAP67448

Target Info

• Gene Symbol: CDH26
• Alias Symbols: VR20
• NCBI Gene Id: 60437
• Description of Target: Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues and modulate a wide variety of processes, including cell polarization and migration. Cadherin domains occur as repeats in the extracellular region and are thought to contribute to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. This gene encodes a cadherin domain-containing protein whose specific function has not yet been determined. Alternative splicing occurs at this locus and two transcript variants, encoding distinct proteins, have been identified.
• Uniprot ID: Q8IXH8
• Protein Accession #: NP_817089
• Nucleotide Accession #: NM_177980
• Protein Size (# AA): 832
• Molecular Weight: 92kDa