CD8A Antibody - middle region (ARP59113_P050)

Catalog No: ARP59113_P050

WB Suggested Anti-CD8A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD8A
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENE
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CD8A (ARP59113_P050) antibody is Catalog # AAP59113 (Previous Catalog # AAPP45093)

Target Info

• Gene Symbol: CD8A
• Gene Full Name: CD8a molecule
• Alias Symbols: CD8, p32, Leu2
• NCBI Gene Id: 925
• Protein Name: T-cell surface glycoprotein CD8 alpha chain
• Description of Target: The CD8 antigen is a cell surface glycoprotein found on most cytotoxic T lymphocytes that mediates efficient cell-cell interactions within the immune system. The CD8 antigen acts as a corepressor with the T-cell receptor on the T lymphocyte to recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. The coreceptor functions as either a homodimer composed of two alpha chains, or as a heterodimer composed of one alpha and one beta chain. Both alpha and beta chains share significant homology to immunoglobulin variable light chains. This gene encodes the CD8 alpha chain isoforms. Multiple transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: P01732
• Protein Accession #: NP_001139345
• Nucleotide Accession #: NM_001145873
• Protein Size (# AA): 235
• Molecular Weight: 24kDa
• Protein Interactions: CACYBP; UBC; CDK1; LNX2; LNX1; SREK1; LAT; SRSF1; CD8A; CD3D; CD8B; LCK; PTPRC; LGALS1; HLA-E; HLA-G; HLA-C; HLA-B; HLA-A; B2M; CD59;