website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

CCT8 antibody - C-terminal region (ARP45837_P050)

Publications:

Anti-CCT8 ARP45837_P050 has recently been referenced in the following publications:

1. Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219–225 (2013). WB, Mouse, Human 23103828

Description of Target:
As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Gene Symbol:
CCT8
Official Gene Full Name:
Chaperonin containing TCP1, subunit 8 (theta)
NCBI Gene Id:
10694
Alias Symbols:
Cctq; D21S246; KIAA0002; PRED71; C21orf112
Sample Type Confirmation:

CCT8 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

Tissue Tool:
Find tissues and cell lines supported to express CCT8.
Protein Accession #:
NP_006576
Nucleotide Accession#:
NM_006585
Swissprot Id:
Q5RAP1
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
T-complex protein 1 subunit theta
Protein Size (# AA):
548
Molecular Weight:
59kDa
Application:
WB
Subunit:
theta
Partner Proteins:
SUP35, SUP45
Immunogen:
The immunogen for anti-CCT8 antibody: synthetic peptide directed towards the C terminal of human CCT8
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
CCT8 antibody - C-terminal region (ARP45837_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%
Species Reactivity:
Human, Yeast, Rat, Dog, Horse, Bovine, Guinea pig, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-CCT8 antibody
- ARP45837_P050
Peptide Sequence:
Synthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
Blocking Peptide:
For anti-CCT8 antibody is Catalog # AAP45837 (Previous Catalog # AAPP26773)
Key Reference:
Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CCT8 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question