website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

CCT8 antibody - C-terminal region (ARP45837_P050)

Description of Target:
As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Gene Symbol:
CCT8
Official Gene Full Name:
Chaperonin containing TCP1, subunit 8 (theta)
NCBI Gene Id:
10694
Alias Symbols:
Cctq; D21S246; KIAA0002; PRED71; C21orf112
Sample Type Confirmation:

CCT8 is strongly supported by BioGPS gene expression data to be expressed in HEK293T, Jurkat

Tissue Tool:
Find tissues and cell lines supported to express CCT8.
Protein Accession #:
NP_006576
Nucleotide Accession#:
NM_006585
Swissprot Id:
Q5RAP1
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
T-complex protein 1 subunit theta
Protein Size (# AA):
548
Molecular Weight:
59kDa
Application:
WB
Subunit:
theta
Partner Proteins:
SUP35, SUP45
Immunogen:
The immunogen for anti-CCT8 antibody: synthetic peptide directed towards the C terminal of human CCT8
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
CCT8 antibody - C-terminal region (ARP45837_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Yeast: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%
Species Reactivity:
Human, Yeast, Rat, Dog, Horse, Bovine, Guinea pig, Mouse, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-CCT8 antibody
- ARP45837_P050
Peptide Sequence:
Synthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
Blocking Peptide:
For anti-CCT8 antibody is Catalog # AAP45837 (Previous Catalog # AAPP26773)
Target Reference:
Suzuki,Y., Gene 200 (1-2), 149-156 (1997)
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CCT8 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Publications:

Anti-CCT8 ARP45837_P050 has recently been referenced in the following publications:

1. Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219–225 (2013). WB, Mouse, Human 23103828

Customer Reviews for CCT8 Antibody (ARP45837_P050) tested with human lymphoblastoid & mouse brain in Western blot

CAT# ARP45837

submitted by: Katheleen Gardiner Ph.D.
human lymphoblastoid cell lysates and mouse brain lysates
30 ug of protein per lane
lysates prepared using sonification
Antibody Detection: incubated in CDP-Star (5 mins)
photographed with Diana camera software

Computational species homology for CCT8 antibody (ARP45837)

Product page for CCT8 antibody (ARP45837)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog cct8 antibody; Xenopus laevis cct8 antibody Q7ZTL5 85%
African elephant CCT8 antibody; Loxodonta africana CCT8 antibody G3SQ75 100%
Atlantic salmon tcpq antibody; Salmo salar tcpq antibody B5X4M2 85%
Bovine Bt.63981 antibody; Bos taurus Bt.63981 antibody G3X861 100%
Bovine CCT8 antibody; Bos taurus CCT8 antibody Q9XSG6 100%
Bovine TCPQ antibody; Bos taurus TCPQ antibody Q3ZCI9 100%
Chicken CCT8 antibody; Gallus gallus CCT8 antibody F1P1N9 100%
Chicken CCT8 antibody; Gallus gallus CCT8 antibody F1NEF2 100%
Chicken TCPQ antibody; Gallus gallus TCPQ antibody Q6EE31 100%
Common turkey CCT8 antibody; Meleagris gallopavo CCT8 antibody G1NNU8 100%
Crab-eating macaque TCPQ antibody; Macaca fascicularis TCPQ antibody Q4R5J0 100%
Dog CCT8 antibody; Canis familiaris CCT8 antibody E2RQ81 100%
Domestic water buffalo CCT8 antibody; Bubalus bubalis CCT8 antibody F6K440 100%
Giant panda LOC100465842 antibody; Ailuropoda melanoleuca LOC100465842 antibody G1LNI2 100%
Gray short-tailed opossum CCT8 antibody; Monodelphis domestica CCT8 antibody F6RKL8 85%
Gray short-tailed opossum CCT8 antibody; Monodelphis domestica CCT8 antibody F6RKL0 85%
Green anole LOC100556769 antibody; Anolis carolinensis LOC100556769 antibody G1KA10 100%
Guinea pig CCT8 antibody; Cavia porcellus CCT8 antibody H0VEJ5 100%
Horse LOC100053750 antibody; Equus caballus LOC100053750 antibody F6ZQE2 100%
Human CCT8 antibody; Homo sapiens CCT8 antibody Q7Z759 100%
Human CCT8 antibody; Homo sapiens CCT8 antibody Q53HU0 100%
Human CCT8 antibody; Homo sapiens CCT8 antibody G5E9B2 100%
Human CCT8 antibody; Homo sapiens CCT8 antibody B4DQH4 100%
Human CCT8 antibody; Homo sapiens CCT8 antibody B4DEM7 100%
Human TCPQ antibody; Homo sapiens TCPQ antibody P50990 100%
Little brown bat CCT8 antibody; Myotis lucifugus CCT8 antibody G1NT53 92%
Lowland gorilla CCT8 antibody; Gorilla gorilla gorilla CCT8 antibody G3QU21 100%
Mouse Cct8 antibody; Mus musculus Cct8 antibody Q9WVS5 100%
Mouse Cct8 antibody; Mus musculus Cct8 antibody Q9CRW7 100%
Mouse Cct8 antibody; Mus musculus Cct8 antibody Q8BVY8 100%
Mouse Cct8 antibody; Mus musculus Cct8 antibody Q6A0F1 100%
Mouse Cct8 antibody; Mus musculus Cct8 antibody Q3UL22 100%
Mouse Cct8 antibody; Mus musculus Cct8 antibody Q3UKQ2 100%
Mouse TCPQ antibody; Mus musculus TCPQ antibody P42932 100%
Northern white-cheeked gibbon CCT8 antibody; Nomascus leucogenys CCT8 antibody G1QSW7 100%
Rabbit CCT8 antibody; Oryctolagus cuniculus CCT8 antibody G1SHZ8 92%
Rainbow trout cct8 antibody; Oncorhynchus mykiss cct8 antibody Q5DW61 85%
Rat Cct8 antibody; Rattus norvegicus Cct8 antibody D4ACB8 100%
Rhesus macaque Mmu.4234 antibody; Macaca mulatta Mmu.4234 antibody F7ELM7 100%
Rhesus macaque Mmu.4234 antibody; Macaca mulatta Mmu.4234 antibody F6VN84 100%
Small-eared galago CCT8 antibody; Otolemur garnettii CCT8 antibody H0WQF0 100%
Sumatran orangutan TCPQ antibody; Pongo abelii TCPQ antibody Q5RAP1 100%
Three-spined stickleback CCT8 antibody; Gasterosteus aculeatus CCT8 antibody G3QBK4 92%
Three-spined stickleback CCT8 antibody; Gasterosteus aculeatus CCT8 antibody G3QBK3 92%
Western clawed frog cct8 antibody; Xenopus tropicalis cct8 antibody Q28EG6 85%
Western clawed frog cct8 antibody; Xenopus tropicalis cct8 antibody F7BZ95 85%
White-tufted-ear marmoset CCT8 antibody; Callithrix jacchus CCT8 antibody F7GNM6 100%
White-tufted-ear marmoset CCT8 antibody; Callithrix jacchus CCT8 antibody F7G3V2 100%
Zebra finch Tgu.5614 antibody; Taeniopygia guttata Tgu.5614 antibody H0ZTP3 100%
Zebrafish cct8 antibody; Danio rerio cct8 antibody Q7ZU96 85%
Zebrafish cct8 antibody; Danio rerio cct8 antibody Q6TNV4 85%

Product Protocols: CCT8 antibody tested with Human Jurkat Cells (ARP45837_P050)

Aviva Systems Biology is the original manufacturer of this CCT8 antibody (ARP45837_P050)

Click here to view the CCT8 antibody Western Blot Protocol

Product Datasheet Link: CCT8 antibody (ARP45837_P050)

WB Suggested Anti-CCT8 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat

Western Blot image:


Description of Target: As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CCT8 antibody (ARP45837_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: CCT8 antibody – C-terminal region (ARP45837_P050) in HEK 293T cells using Western Blot

Product Page Link: CCT8 antibody - C-terminal region (ARP45837_P050)

Data provided by Dr. Amy Gray of Bringham Young University, Provo, Utah

Experimental sample and Preparation: HEK 293T cells, prepared by lysing cells with 1% NP-40 in PBS supplemented with protease inhibitors

Applications: I tested the antibodies in a co-IP (3ug Ab per 400ug total protein in cell extract) and immunoblot (1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies)

Cell Lysate Preparation: HEK 293T cells were lysed in cell lysis buffer (1% NP-40, PBS, 0.6 mM PMSF, 6μg/ml protease inhibitor cocktail (Sigma)). Cell lysates were triturated 8-10 times with a 25-gauge needle. Cell lysates were spun down at 21,100g in a micro-centrifuge for 10 min at 4°C. DC protein assay (BioRad) was performed on the cleared lysate. 

 Western Blot Preparation: Solubilized samples were separated by SDS-PAGE on 10% Tris-Glycine-SDS gels as follows: Lane 1 - negative control (anti-FLAG antibody), Lane 2 - immunoprecipitation with indicated CCT polyclonal antibodies, Lane 3 - 10 μg lysate. Gels were transferred to nitrocellulose membrane using an iBlot (Invitrogen) at 20 V for 7 min. Blots were blocked in 1:1 PBS and Li-Cor blocking buffer (Li-Cor) for 1 hour. Blots were incubated overnight at 4°C with rotation with the indicated CCT polyclonal antibody at a 1:1,000 dilution. Blots were then washed 3 times in TBS-T and incubated at 4°C with rotation for 1 hour with a goat anti-rabbit secondary antibody with a conjugated infrared dye (Cat. No. 926-32211, Li-Cor Biosciences) at a 1:10,000 dilution. Blots were washed again 3 times in TBS-T and scanned using an Odyssey Infrared Imaging System (Li-Cor Biosciences).   

Controls: Negative control: (IP with a non-specific antibody) Positive control (10ug cleared cell extract)

Lane 1 - negative control (anti-FLAG antibody), Lane 2 - immunoprecipitation with indicated CCT polyclonal antibodies, Lane 3 - 10 μg lysate.

 
X
Ask a Question