website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

CCR5 antibody - middle region (ARP30788_P050)

Receive a free blocking peptide (AAP30788) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
CCR5 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this protein was also detected in a promyeloblastic cell line, suggesting that CCR5 may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene.This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene.
Gene Symbol:
CCR5
Official Gene Full Name:
Chemokine (C-C motif) receptor 5 (gene/pseudogene)
NCBI Gene Id:
1234
Alias Symbols:
CC-CKR-5; CCCKR5; CD195; CKR-5; CKR5; CMKBR5; IDDM22
Tissue Tool:
Find tissues and cell lines supported to express CCR5.
Protein Accession #:
NP_000570
Nucleotide Accession#:
NM_000579
Swissprot Id:
P51681
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
C-C chemokine receptor type 5
Protein Size (# AA):
352
Molecular Weight:
41kDa
Application:
WB
Partner Proteins:
CXCL12, ADRBK2, ARRB2, CCR5, CD4, CTSG, CXCL12, CXCR4, DPP4, ELANE, GNA13, GNAI1, HSPA8, JAK1, JAK2, JAK3, MYH9, PTK2, PTPN11, PTPN6, PTPRC, SDC4, SOCS1, SOCS3, STAT1, STAT2, STAT3, STAT5B, VAV1, ADRBK2, CCR5, CD4, ITCH, JAK2, JAK3, PTK2, PTPN6, SOCS3, UBC, USP14
Immunogen:
The immunogen for anti-CCR5 antibody: synthetic peptide directed towards the middle region of human CCR5
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
CCR5 antibody - middle region (ARP30788_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Human: 100%; Bovine: 92%
Species Reactivity:
Human, Pig, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-CCR5 antibody
- ARP30788_P050
Peptide Sequence:
Synthetic peptide located within the following region: SHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKK
Blocking Peptide:
For anti-CCR5 antibody is Catalog # AAP30788 (Previous Catalog # AAPP01451)
Key Reference:
Catano,G., (2008) J. Infect. Dis. 198 (1), 72-80
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CCR5 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question