website statistics
Account Login 

Aviva Systems Biology office will be closed for Christmas and New Year holidays - 12/24/2014, 12/25/2014 and 1/1/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

CCR5 antibody - middle region (ARP30788_P050)

Receive a free blocking peptide (AAP30788) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
CCR5 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this protein was also detected in a promyeloblastic cell line, suggesting that CCR5 may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene.This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene.
Gene Symbol:
CCR5
Official Gene Full Name:
Chemokine (C-C motif) receptor 5 (gene/pseudogene)
NCBI Gene Id:
1234
Alias Symbols:
CC-CKR-5; CCCKR5; CD195; CKR-5; CKR5; CMKBR5; IDDM22
Tissue Tool:
Find tissues and cell lines supported to express CCR5.
Protein Accession #:
NP_000570
Nucleotide Accession#:
NM_000579
Swissprot Id:
P51681
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
C-C chemokine receptor type 5
Protein Size (# AA):
352
Molecular Weight:
41kDa
Application:
WB
Partner Proteins:
CXCL12, ADRBK2, ARRB2, CCR5, CD4, CTSG, CXCL12, CXCR4, DPP4, ELANE, GNA13, GNAI1, HSPA8, JAK1, JAK2, JAK3, MYH9, PTK2, PTPN11, PTPN6, PTPRC, SDC4, SOCS1, SOCS3, STAT1, STAT2, STAT3, STAT5B, VAV1, ADRBK2, CCR5, CD4, ITCH, JAK2, JAK3, PTK2, PTPN6, SOCS3, UBC, USP14
Immunogen:
The immunogen for anti-CCR5 antibody: synthetic peptide directed towards the middle region of human CCR5
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
CCR5 antibody - middle region (ARP30788_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Human: 100%; Bovine: 92%
Species Reactivity:
Human, Pig, Bovine
Datasheets / Downloads:
Printable datasheet for
anti-CCR5 antibody
- ARP30788_P050
Peptide Sequence:
Synthetic peptide located within the following region: SHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKK
Blocking Peptide:
For anti-CCR5 antibody is Catalog # AAP30788 (Previous Catalog # AAPP01451)
Target Reference:
Catano,G., (2008) J. Infect. Dis. 198 (1), 72-80
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CCR5 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for CCR5 antibody (ARP30788)

Product page for CCR5 antibody (ARP30788)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant CCR5 antibody; Loxodonta africana CCR5 antibody B2BJC2 92%
Angolan talapoin CCR5 antibody; Miopithecus talapoin CCR5 antibody Q95NC3 100%
Assam macaque CCR5 antibody; Macaca assamensis CCR5 antibody Q7JJ33 100%
Black crested gibbon CCR5 antibody; Nomascus concolor CCR5 antibody Q9TUX1 100%
Black crested gibbon CCR5 antibody; Nomascus concolor CCR5 antibody Q9TUX0 100%
Black crested gibbon CCR5 antibody; Nomascus concolor CCR5 antibody Q9TUW9 100%
Black crested gibbon CCR5 antibody; Nomascus concolor CCR5 antibody Q9TQW0 100%
Black crested mangabey CCR5 antibody; Lophocebus aterrimus CCR5 antibody P61755 100%
Black howler monkey CCR5 antibody; Alouatta caraya CCR5 antibody Q9TUV2 91%
Black howler monkey CCR5 antibody; Alouatta caraya CCR5 antibody Q9TUR5 91%
Black snub-nosed monkey CCR5 antibody; Pygathrix bieti CCR5 antibody O97880 100%
Black-and-white colobus monkey CCR5 antibody; Colobus guereza CCR5 antibody Q9XT14 100%
Black-and-white colobus monkey CCR5 antibody; Colobus guereza CCR5 antibody Q9TQV6 100%
Black-cheeked white-nosed monkey CCR5 antibody; Cercopithecus ascanius CCR5 antibody Q9TV48 92%
Black-handed spider monkey CCR5 antibody; Ateles geoffroyi CCR5 antibody Q95NC4 91%
Blue monkey CCR5 antibody; Cercopithecus mitis CCR5 antibody Q9BGN5 100%
Bornean orangutan CCR5 antibody; Pongo pygmaeus CCR5 antibody O97881 100%
Bornean orangutan CCR5 antibody; Pongo pygmaeus CCR5 antibody Q9TUW3 100%
Bornean orangutan CCR5 antibody; Pongo pygmaeus CCR5 antibody Q9TQW2 100%
Bovine CCR5 antibody; Bos taurus CCR5 antibody Q2HJ17 92%
Broom hare CCR5 antibody; Lepus castroviejoi CCR5 antibody D0V7B7 84%
Cat CCR5 antibody; Felis catus CCR5 antibody Q867D6 91%
Cat CCR5 antibody; Felis catus CCR5 antibody B6DXF3 91%
Cat CCR5 antibody; Felis catus CCR5 antibody A4ZY83 91%
Cat CCR5 antibody; Felis catus CCR5 antibody A4ZY82 91%
Cat CCR5 antibody; Felis catus CCR5 antibody A4ZY81 91%
Cat CCR5 antibody; Felis catus CCR5 antibody A4ZY78 91%
Celebes black macaque CCR5 antibody; Macaca nigra CCR5 antibody Q71TZ7 100%
Cercocebus torquatus torquatus CCR5 antibody Q9TQR8 100%
Cercocebus torquatus torquatus CCR5 antibody Q71RS2 100%
Cercocebus torquatus torquatus CCR5 antibody O77833 100%
Cercocebus torquatus torquatus CCR5 antibody O77776 100%
Chimpanzee CCR5 antibody; Pan troglodytes CCR5 antibody P56440 100%
Chimpanzee CCR5 antibody; Pan troglodytes CCR5 antibody Q9TV50 100%
Chimpanzee CCR5 antibody; Pan troglodytes CCR5 antibody Q9TUW6 100%
Chimpanzee CCR5 antibody; Pan troglodytes CCR5 antibody Q9TUW5 100%
Chimpanzee CCR5 antibody; Pan troglodytes CCR5 antibody Q9TUW4 100%
Chimpanzee CCR5 antibody; Pan troglodytes CCR5 antibody Q9TQW4 100%
Chimpanzee CCR5 antibody; Pan troglodytes CCR5 antibody O18772 100%
Chimpanzee CCR5 antibody; Pan troglodytes CCR5 antibody O18771 100%
Chimpanzee CCR5 antibody; Pan troglodytes CCR5 antibody O18770 100%
Chimpanzee CCR5 antibody; Pan troglodytes CCR5 antibody Q9TUW7 92%
Chlorocebus aethiops vervet CCR5 antibody Q9TUR8 100%
Chlorocebus aethiops vervet CCR5 antibody Q9TUR7 100%
Chlorocebus aethiops vervet CCR5 antibody Q9TUR6 100%
Common squirrel monkey CCR5 antibody; Saimiri sciureus CCR5 antibody Q8HZT9 78%
Common woolly monkey CCR5 antibody; Lagothrix lagotricha CCR5 antibody Q9MZA1 91%
Crab-eating macaque CCR5 antibody; Macaca fascicularis CCR5 antibody P61814 100%
Crab-eating macaque CCR5 antibody; Macaca fascicularis CCR5 antibody Q9TSN3 100%
Crab-eating macaque CCR5 antibody; Macaca fascicularis CCR5 antibody Q9TSN2 100%
Crab-eating macaque CCR5 antibody; Macaca fascicularis CCR5 antibody Q9TQT0 100%
Debrazza monkey CCR5 antibody; Cercopithecus neglectus CCR5 antibody Q9XT12 100%
Debrazza monkey CCR5 antibody; Cercopithecus neglectus CCR5 antibody Q9TV46 100%
Diana monkey CCR5 antibody; Cercopithecus diana CCR5 antibody Q9TUU9 100%
Diana monkey CCR5 antibody; Cercopithecus diana CCR5 antibody Q9TUU8 100%
Dove langur CCR5 antibody; Pygathrix nemaeus CCR5 antibody O97882 100%
Drill CCR5 antibody; Mandrillus leucophaeus CCR5 antibody Q95ND2 92%
eastern lowland gorilla CCR5 antibody; Gorilla beringei graueri CCR5 antibody Q71TZ1 100%
European hare CCR5 antibody; Lepus europaeus CCR5 antibody Q1AFX9 84%
Francois leaf monkey CCR5 antibody; Trachypithecus francoisi CCR5 antibody O97878 100%
Gelada baboon CCR5 antibody; Theropithecus gelada CCR5 antibody Q95NC1 100%
Golden snub-nosed monkey CCR5 antibody; Pygathrix roxellana CCR5 antibody Q7JJ34 100%
Granada hare CCR5 antibody; Lepus granatensis CCR5 antibody Q1AFX8 84%
Greater white-nosed monkey CCR5 antibody; Cercopithecus nictitans CCR5 antibody Q9TV45 100%
Greater white-nosed monkey CCR5 antibody; Cercopithecus nictitans CCR5 antibody Q9TUQ8 100%
Greater white-nosed monkey CCR5 antibody; Cercopithecus nictitans CCR5 antibody Q9TQU7 100%
Greater white-nosed monkey CCR5 antibody; Cercopithecus nictitans CCR5 antibody Q9TQU5 100%
Green monkey CCR5 antibody; Cercopithecus sabaeus CCR5 antibody Q9TV43 100%
Green monkey CCR5 antibody; Chlorocebus aethiops CCR5 antibody P56493 100%
Green monkey CCR5 antibody; Chlorocebus aethiops CCR5 antibody Q9TSQ7 100%
Green monkey CCR5 antibody; Chlorocebus aethiops CCR5 antibody Q9TSQ4 100%
Green monkey CCR5 antibody; Chlorocebus aethiops CCR5 antibody Q9TSQ3 100%
Green monkey CCR5 antibody; Chlorocebus aethiops CCR5 antibody Q9TSQ1 100%
Green monkey CCR5 antibody; Chlorocebus aethiops CCR5 antibody Q9TQU6 100%
Green monkey CCR5 antibody; Chlorocebus aethiops CCR5 antibody Q9TQU4 100%
Green monkey CCR5 antibody; Chlorocebus aethiops CCR5 antibody A9LK39 100%
Green monkey CCR5 antibody; Chlorocebus aethiops CCR5 antibody Q9TSQ2 100%
Green monkey ccr5 antibody; Chlorocebus aethiops ccr5 antibody Q9TQX0 92%
Guinea baboon CCR5 antibody; Papio papio CCR5 antibody Q9TUS9 100%
Guinea baboon CCR5 antibody; Papio papio CCR5 antibody Q9TUS8 100%
Guinea baboon CCR5 antibody; Papio papio CCR5 antibody Q9TUS7 100%
Guinea baboon CCR5 antibody; Papio papio CCR5 antibody Q9TUS6 100%
Guinea baboon CCR5 antibody; Papio papio CCR5 antibody Q9TUS5 100%
Guinea baboon CCR5 antibody; Papio papio CCR5 antibody Q9TQV2 100%
Guinea baboon CCR5 antibody; Papio papio CCR5 antibody Q9TQV0 100%
Hamadryas baboon CCR5 antibody; Papio hamadryas CCR5 antibody P68270 100%
Hanuman langur CCR5 antibody; Semnopithecus entellus CCR5 antibody P61757 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody P51681 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q9UN28 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q9UN27 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q9UN26 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q9UN25 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q9UN24 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q9UN23 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q9UBT9 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q9UBJ7 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q9P1T5 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q9P1T4 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q5QIP0 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q5QIN9 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q5KSY4 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q5EKN0 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q5EKM9 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q5EKM8 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q3L3Q6 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q38L21 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody O14694 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody B8LFN8 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody B2KKJ9 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody B2KIU2 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody B2KIU1 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody B2KIU0 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody B0EX01 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody B0EX00 100%
Human CCR5 antibody; Homo sapiens CCR5 antibody Q5QIP1 92%
Hylobates agilis unko CCR5 antibody Q9MZA3 100%
Japanese macaque CCR5 antibody; Macaca fuscata CCR5 antibody Q9TUU7 100%
Japanese macaque CCR5 antibody; Macaca fuscata CCR5 antibody Q9TUU6 100%
Japanese macaque CCR5 antibody; Macaca fuscata CCR5 antibody Q9TUU5 100%
LHoest monkey CCR5 antibody; Cercopithecus lhoesti CCR5 antibody Q9XT76 100%
Lowland gorilla CCR5 antibody; Gorilla gorilla gorilla CCR5 antibody P56439 100%
Lowland gorilla CCR5 antibody; Gorilla gorilla gorilla CCR5 antibody Q9TUW8 100%
Lowland gorilla CCR5 antibody; Gorilla gorilla gorilla CCR5 antibody Q9TQR2 100%
Lowland gorilla CCR5 antibody; Gorilla gorilla gorilla CCR5 antibody Q549B2 100%
Mandrill CCR5 antibody; Mandrillus sphinx CCR5 antibody Q95ND1 92%
Mandrill CCR5 antibody; Mandrillus sphinx CCR5 antibody Q9TUR4 92%
Mandrill CCR5 antibody; Mandrillus sphinx CCR5 antibody Q9TQX3 92%
Mona monkey CCR5 antibody; Cercopithecus mona CCR5 antibody Q9TUR1 100%
Mona monkey CCR5 antibody; Cercopithecus mona CCR5 antibody Q9TUR0 100%
Mona monkey CCR5 antibody; Cercopithecus mona CCR5 antibody Q9TUQ9 100%
Mona monkey CCR5 antibody; Cercopithecus mona CCR5 antibody Q9TQV3 100%
Mountain arctic hare CCR5 antibody; Lepus timidus CCR5 antibody D0V7C0 84%
Mountain gorilla CCR5 antibody; Gorilla gorilla beringei CCR5 antibody Q71TZ0 100%
Mouse CCR5 antibody; Mus musculus CCR5 antibody P51682 83%
Mouse Ccr5 antibody; Mus musculus Ccr5 antibody Q3TDA4 83%
Moustached monkey CCR5 antibody; Cercopithecus cephus CCR5 antibody Q9TV47 100%
Night monkey CCR5 antibody; Aotus trivirgatus CCR5 antibody Q9TUV1 91%
Night monkey CCR5 antibody; Aotus trivirgatus CCR5 antibody Q9TUV0 91%
Nilgiri langur CCR5 antibody; Trachypithecus johnii CCR5 antibody Q95NC6 100%
Northern white-cheeked gibbon CCR5 antibody; Nomascus leucogenys CCR5 antibody O97883 100%
Olive baboon CCR5 antibody; Papio anubis CCR5 antibody P68269 100%
Olive baboon CCR5 antibody; Papio anubis CCR5 antibody Q9XT13 100%
Pan troglodytes troglodytes CCR5 antibody C0KUU2 100%
Pan troglodytes troglodytes CCR5 antibody C0KUT9 100%
Pan troglodytes troglodytes CCR5 antibody C0KUS8 100%
Pan troglodytes troglodytes CCR5 antibody C0KUS5 100%
Pan troglodytes vellerosus CCR5 antibody C0KUW1 100%
Pan troglodytes vellerosus CCR5 antibody C0KUW0 100%
Pan troglodytes vellerosus CCR5 antibody C0KUV6 100%
Pan troglodytes vellerosus CCR5 antibody C0KUV0 100%
Pan troglodytes vellerosus CCR5 antibody C0KUU7 100%
Pan troglodytes vellerosus CCR5 antibody C0KUU5 100%
Pan troglodytes verus CCR5 antibody C0KUW2 100%
Phayre leaf monkey CCR5 antibody; Trachypithecus phayrei CCR5 antibody O97879 100%
Pig CCR5 antibody; Sus scrofa CCR5 antibody Q6YT41 92%
Pig-tailed macaque CCR5 antibody; Macaca nemestrina CCR5 antibody P61815 100%
Pig-tailed macaque ccr5 antibody; Macaca nemestrina ccr5 antibody Q9XS35 100%
Pig-tailed macaque CCR5 antibody; Macaca nemestrina CCR5 antibody Q9TUT5 100%
Pig-tailed macaque CCR5 antibody; Macaca nemestrina CCR5 antibody Q9TUT4 100%
Pig-tailed macaque CCR5 antibody; Macaca nemestrina CCR5 antibody Q9TUT2 100%
Pig-tailed macaque CCR5 antibody; Macaca nemestrina CCR5 antibody Q9TUT1 100%
Pig-tailed macaque CCR5 antibody; Macaca nemestrina CCR5 antibody Q9TUT0 100%
Pig-tailed macaque CCR5 antibody; Macaca nemestrina CCR5 antibody Q9TQT2 100%
Pig-tailed macaque CCR5 antibody; Macaca nemestrina CCR5 antibody Q53Z80 100%
Pig-tailed macaque CCR5 antibody; Macaca nemestrina CCR5 antibody Q9TUT3 92%
Pig-tailed macaque CCR5 antibody; Macaca nemestrina CCR5 antibody Q9TUT6 92%
Pongo pygmaeus pygmaeus CCR5 antibody Q71TZ2 100%
Preuss monkey CCR5 antibody; Cercopithecus preussi CCR5 antibody Q7JI84 100%
Proboscis monkey CCR5 antibody; Nasalis larvatus CCR5 antibody Q95NC7 100%
Pygmy chimpanzee CCR5 antibody; Pan paniscus CCR5 antibody P60574 100%
Pygmy marmoset ccr5 antibody; Cebuella pygmaea ccr5 antibody Q6WN97 85%
Rabbit CCR5 antibody; Oryctolagus cuniculus CCR5 antibody Q1ZY22 90%
Red guenon CCR5 antibody; Erythrocebus patas CCR5 antibody Q95ND0 100%
Red guenon CCR5 antibody; Erythrocebus patas CCR5 antibody Q9TV44 100%
Red guenon CCR5 antibody; Erythrocebus patas CCR5 antibody Q9TUR3 100%
Red guenon CCR5 antibody; Erythrocebus patas CCR5 antibody Q9TUR2 100%
Red guenon CCR5 antibody; Erythrocebus patas CCR5 antibody Q9TUQ7 100%
Red guenon CCR5 antibody; Erythrocebus patas CCR5 antibody Q9TUQ6 100%
Red guenon CCR5 antibody; Erythrocebus patas CCR5 antibody Q9TUQ4 100%
Red guenon CCR5 antibody; Erythrocebus patas CCR5 antibody Q9TQX2 100%
Red guenon CCR5 antibody; Erythrocebus patas CCR5 antibody Q9TUQ5 92%
Red howler monkey CCR5 antibody; Alouatta seniculus CCR5 antibody Q95NC9 91%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody P61813 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q9TUU4 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q9TUU3 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q9TUU2 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q9TUU1 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q9TUU0 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q9TUT9 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q9TUT8 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q9TUT7 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q9TQT1 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q09GY8 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q09GX6 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q09GV8 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q09GU2 100%
Rhesus macaque CCR5 antibody; Macaca mulatta CCR5 antibody Q09GT7 100%
Ring-tailed lemur CCR5 antibody; Lemur catta CCR5 antibody Q9TUS3 100%
Ring-tailed lemur CCR5 antibody; Lemur catta CCR5 antibody Q9TUS2 100%
Ring-tailed lemur CCR5 antibody; Lemur catta CCR5 antibody Q9TQU3 100%
Ruffed lemur CCR5 antibody; Lemur variegatus CCR5 antibody Q9TUS4 100%

Product Protocols: CCR5 antibody tested with Human Fetal Heart Tissue (ARP30788_P050)

Aviva Systems Biology is the original manufacturer of this CCR5 antibody (ARP30788_P050)

Click here to view the CCR5 antibody Western Blot Protocol

Product Datasheet Link: CCR5 antibody (ARP30788_P050)

WB Suggested Anti-CCR5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Heart

Western Blot image:


Description of Target: CCR5 is a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. The protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this protein was also detected in a promyeloblastic cell line, suggesting that CCR5 may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene.This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CCR5 antibody (ARP30788_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question