CCNB3 Antibody - N-terminal region (ARP39739_T100)

Catalog No: ARP39739_T100

WB Suggested Anti-CCNB3 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCNB3
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: MLLPLPPQSSKPVPKKSQSSKIVPSHHDPSEKTGENCQTKISPSSLQESP
• Concentration: 1.0 mg/ml
• Blocking Peptide: For anti-CCNB3 (ARP39739_T100) antibody is Catalog # AAP39739 (Previous Catalog # AAPS03409)
• Reference: Nguyen,T.B., (2002) J. Biol. Chem. 277 (44), 41960-41969
• Publications:

  Mutation of Eif4g3, encoding a eukaryotic translation initiation factor, causes male infertility and meiotic arrest of mouse spermatocytes. Development. 137, 1699-707 (2010). 20430745

• Description:
  View product citations for CCNB3 Antibody - N-terminal region (ARP39739_T100) on CiteAb

Target Info

• Gene Symbol: CCNB3
• Gene Full Name: Cyclin B3
• Alias Symbols: CYCB3
• NCBI Gene Id: 85417
• Description of Target: CCNB3 belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event.This cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus.The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance through the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhibit distinct expression and degradation patterns which contribute to the temporal coordination of each mitotic event. Studies of similar genes in chick and Drosophila suggest that this cyclin may associate with CDC2 and CDK2 kinases, and be required for proper spindle reorganization and restoration of the interphase nucleus. Two transcript variants encoding different isoforms have been found for this gene.
• Uniprot ID: Q8WWL7
• Protein Accession #: NP_391991
• Nucleotide Accession #: NM_033671
• Protein Size (# AA): 111
• Molecular Weight: 12kDa
• Protein Interactions: APP; CDK2;