website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

Ccna2 antibody - C-terminal region (ARP30159_P050)

Receive a free blocking peptide (AAP30159) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
The function of Ccna2 remains unknown.
Gene Symbol:
Official Gene Full Name:
Cyclin A2
NCBI Gene Id:
Alias Symbols:
MGC156527; Ccna2
Tissue Tool:
Find tissues and cell lines supported to express Ccna2.
Protein Accession #:
Nucleotide Accession#:
Protein Size (# AA):
Molecular Weight:
The immunogen for anti-Ccna2 antibody: synthetic peptide corresponding to a region of Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Ccna2 antibody - C-terminal region (ARP30159_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Yeast: 82%; Zebrafish: 77%
Species Reactivity:
Sheep, Pig, Rabbit, Rat, Bovine, Guinea pig, Human, Dog, Horse, Mouse, Yeast, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-Ccna2 antibody
- ARP30159_P050
Peptide Sequence:
Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET
Blocking Peptide:
For anti-Ccna2 antibody is Catalog # AAP30159 (Previous Catalog # AAPS08605)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Customer Reviews for Ccna2 Antibody (ARP30159_P050) tested with testis in Western blot

CAT# ARP30159_P050

Ccna2 antibody

Ccna2 antibody Western Blot

Ccna2 antibody Testis Extract

submitted by:
Sunil Panigrahi
University of Columbia Medical Center

Computational species homology for Ccna2 antibody (ARP30159)

Product page for Ccna2 antibody (ARP30159)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African clawed frog CCNA1 antibody; Xenopus laevis CCNA1 antibody P18606 75%
African clawed frog LOC397885 antibody; Xenopus laevis LOC397885 antibody Q6GME9 75%
African elephant CCNA1 antibody; Loxodonta africana CCNA1 antibody G3SMW8 83%
African elephant CCNA2 antibody; Loxodonta africana CCNA2 antibody G3T3V6 100%
Alpaca ccna1 antibody; Lama guanicoe pacos ccna1 antibody E5LLE1 83%
Bovine Bt.87491 antibody; Bos taurus Bt.87491 antibody G8JKW1 100%
Bovine CCNA1 antibody; Bos taurus CCNA1 antibody F1MVR8 83%
Bovine CCNA2 antibody; Bos taurus CCNA2 antibody P30274 100%
Chicken CCNA2 antibody; Gallus gallus CCNA2 antibody P43449 84%
Chicken CCNA2 antibody; Gallus gallus CCNA2 antibody F1NQG1 84%
Chicken CCNA2 antibody; Gallus gallus CCNA2 antibody F1NJI2 84%
Chimpanzee CCNA1 antibody; Pan troglodytes CCNA1 antibody G2HFV8 83%
Common limpet CCNA antibody; Patella vulgata CCNA antibody P24861 76%
Common turkey CCNA2 antibody; Meleagris gallopavo CCNA2 antibody G1NDV2 84%
Dog CCNA1 antibody; Canis familiaris CCNA1 antibody F1PYU7 83%
Dog CCNA2 antibody; Canis familiaris CCNA2 antibody E2RQA2 92%
Dog CCNA2 antibody; Canis familiaris CCNA2 antibody E2RLW0 92%
Duckbill platypus CCNA2 antibody; Ornithorhynchus anatinus CCNA2 antibody F6XUA8 84%
Duckbill platypus CCNA2 antibody; Ornithorhynchus anatinus CCNA2 antibody F6XUA0 84%
Giant panda CCNA2 antibody; Ailuropoda melanoleuca CCNA2 antibody D2HN58 92%
Golden hamster CCNA2 antibody; Mesocricetus auratus CCNA2 antibody P37881 92%
Gray short-tailed opossum CCNA1 antibody; Monodelphis domestica CCNA1 antibody F6USE6 83%
Guinea pig CCNA1 antibody; Cavia porcellus CCNA1 antibody H0UYY2 83%
Guinea pig LOC100716947 antibody; Cavia porcellus LOC100716947 antibody H0VGR5 100%
Horse CCNA2 antibody; Equus caballus CCNA2 antibody F6XEH8 92%
Horse LOC100147188 antibody; Equus caballus LOC100147188 antibody F7DJ56 83%
Human CCNA1 antibody; Homo sapiens CCNA1 antibody P78396 83%
Human CCNA1 antibody; Homo sapiens CCNA1 antibody P78396-2 83%
Human CCNA1 antibody; Homo sapiens CCNA1 antibody B7Z7E3 83%
Human CCNA2 antibody; Homo sapiens CCNA2 antibody P20248 100%
Little brown bat CCNA1 antibody; Myotis lucifugus CCNA1 antibody G1NT21 83%
Lowland gorilla CCNA1 antibody; Gorilla gorilla gorilla CCNA1 antibody G3SD32 83%
Lowland gorilla CCNA2 antibody; Gorilla gorilla gorilla CCNA2 antibody G3QIC8 100%
Mouse CCNA1 antibody; Mus musculus CCNA1 antibody Q61456 83%
Mouse CCNA2 antibody; Mus musculus CCNA2 antibody P51943 92%
Northern white-cheeked gibbon CCNA1 antibody; Nomascus leucogenys CCNA1 antibody G1S0F4 83%
Northern white-cheeked gibbon CCNA2 antibody; Nomascus leucogenys CCNA2 antibody G1RDS0 92%
Pig CCNA1 antibody; Sus scrofa CCNA1 antibody F1RSR0 83%
Pig CCNA2 antibody; Sus scrofa CCNA2 antibody D5HP13 100%
Rabbit CCNA2 antibody; Oryctolagus cuniculus CCNA2 antibody G1TSN9 100%
Rabbit LOC100352785 antibody; Oryctolagus cuniculus LOC100352785 antibody G1SIX8 100%
Rat CCNA1 antibody; Rattus norvegicus CCNA1 antibody Q6AY13 83%
Rat Ccna2 antibody; Rattus norvegicus Ccna2 antibody Q6GX89 92%
Rat Ccna2 antibody; Rattus norvegicus Ccna2 antibody Q6GX88 92%
Rat Ccna2 antibody; Rattus norvegicus Ccna2 antibody G3V802 92%
Rat Ccna2 antibody; Rattus norvegicus Ccna2 antibody F1LRT7 92%
Rat Ccna2 antibody; Rattus norvegicus Ccna2 antibody A0JPK0 92%
Rhesus macaque CCNA1 antibody; Macaca mulatta CCNA1 antibody F6RGI5 83%
Rhesus macaque CCNA2 antibody; Macaca mulatta CCNA2 antibody F6WZV1 100%
Small-eared galago CCNA1 antibody; Otolemur garnettii CCNA1 antibody H0X2J7 83%
Small-eared galago CCNA2 antibody; Otolemur garnettii CCNA2 antibody H0XEN5 100%
Tasmanian devil CCNA1 antibody; Sarcophilus harrisii CCNA1 antibody G3VMK9 83%
Tasmanian devil CCNA1 antibody; Sarcophilus harrisii CCNA1 antibody G3VMK8 83%
Tasmanian devil CCNA2 antibody; Sarcophilus harrisii CCNA2 antibody G3VF80 84%
Three-spined stickleback CCNA1 antibody; Gasterosteus aculeatus CCNA1 antibody G3QBB4 83%
White-tufted-ear marmoset CCNA2 antibody; Callithrix jacchus CCNA2 antibody F7ILU7 92%
Zebra finch CCNA2 antibody; Taeniopygia guttata CCNA2 antibody H0YUN6 84%
Zebrafish ccna1 antibody; Danio rerio ccna1 antibody Q7T3L6 76%
Zebrafish ccna1 antibody; Danio rerio ccna1 antibody F1QGH4 76%
Zebrafish ccna2 antibody; Danio rerio ccna2 antibody Q98TA3 76%
Zebrafish ccna2 antibody; Danio rerio ccna2 antibody Q6NV43 76%

Product Protocols: Ccna2 antibody tested with Human Rat Muscle Tissue (ARP30159_P050)

Aviva Systems Biology is the original manufacturer of this Ccna2 antibody (ARP30159_P050)

Click here to view the Ccna2 antibody Western Blot Protocol

Product Datasheet Link: Ccna2 antibody (ARP30159_P050)

WB Suggested Anti-Ccna2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Muscle

Western Blot image:

Description of Target: The function of Ccna2 remains unknown.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s Ccna2 antibody (ARP30159_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question