website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Ccna2 antibody - C-terminal region (ARP30159_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul
In Stock

Conjugation Options

ARP30159_P050-FITC Conjugated

ARP30159_P050-HRP Conjugated

ARP30159_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Cyclin A2
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
MGC156527, Ccna2
Replacement Item:
This antibody may replace item sc-136253 from Santa Cruz Biotechnology.
Description of Target:
The function of Ccna2 remains unknown.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ccna2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ccna2.
The immunogen is a synthetic peptide corresponding to a region of Rat
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 82%; Zebrafish: 77%
Complete computational species homology data:
Anti-Ccna2 (ARP30159_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-Ccna2 (ARP30159_P050) antibody is Catalog # AAP30159 (Previous Catalog # AAPS08605)
Datasheets / Downloads:
Printable datasheet for anti-Ccna2 (ARP30159_P050) antibody

Customer Reviews for Ccna2 Antibody (ARP30159_P050) tested with testis in Western blot

CAT# ARP30159_P050

Ccna2 antibody

Ccna2 antibody Western Blot

Ccna2 antibody Testis Extract

submitted by:
Sunil Panigrahi
University of Columbia Medical Center

Product Protocols: Ccna2 antibody tested with Human Rat Muscle Tissue (ARP30159_P050)

Aviva Systems Biology is the original manufacturer of this Ccna2 antibody (ARP30159_P050)

Click here to view the Ccna2 antibody Western Blot Protocol

Product Datasheet Link: Ccna2 antibody (ARP30159_P050)

WB Suggested Anti-Ccna2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Muscle

Western Blot image:

Description of Target: The function of Ccna2 remains unknown.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s Ccna2 antibody (ARP30159_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Protocol: CCNA2 Antibody (ARP30159_P050) in Human Lymph Node Tissue using Immunohistochemistry

Aviva Systems Biology is the original manufacturer of this CCNA2 antibody.
Product Datasheet Link: CCNA2 antibody ARP30159_P050

Rabbit Anti-CCNA2 Antibody
Catalog Number: ARP30159_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:600
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Left to right:
DAPI, CCNA2 Ab, Merge

Control Image:
Control Antibody: Normal Rabbit IgG
Control Antibody Concentration: 1:100

Left to right:
DAPI, Rabbit IgG, Merge

1. Normal adult human lymph node tissue was formalin fixed, embedded in paraffin wax, sectioned at 6 micron thickness and put on histological slides.
2. After deparaffinization and rehydration, the low pH, heat-induced antigen retrieval method utilizing Sodium Citrate buffer was performed.
3. The blocking buffer was 5% normal goat serum.
4. Primary antibodies was diluted in antibody dilution buffer (1% Normal Donkey Serum) to the final testing dilution (1:100, 1:600, 1:1200).
5. The appropriate anti-rabbit fluorescent-conjugated (Rhodamine:red or FITC:green) secondary antibody was applied and nuclei will be counterstained with DAPI (blue).
6. A Negative control utilized a nonspecific rabbit IgG staining the same normal adult human lymph node tissue.

Ask a Question

Tell us what you think about this item!

Write A Review
    Please, wait...