website statistics

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

Ccna2 antibody - C-terminal region (ARP30159_P050)

  • Catalog#: ARP30159_P050
  • Domestic: within 1-2 days delivery International: 1-2 days

    *** Required Wet/Dry Ice Surcharge will automatically be applied upon checkout for the shipment. See Surcharges

    - Trial Size Available. Trial size is not available for conjugation.
Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    Ccna2
    NCBI Gene Id:
    114494
    Official Gene Full Name:
    Cyclin A2
    Protein Accession #:
    NP_446154
    Nucleotide Accession #:
    NM_053702
    Alias Symbols:
    MGC156527, Ccna2
    Description of Target:
    The function of Ccna2 remains unknown.
    Protein Size (# AA):
    418
    Molecular Weight:
    47kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB, IHC
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express Ccna2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express Ccna2.
    Immunogen:
    The immunogen is a synthetic peptide corresponding to a region of Rat
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast: 82%; Zebrafish: 77%
    Complete computational species homology data:
    Anti-Ccna2 (ARP30159_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Blocking Peptide:
    For anti-Ccna2 (ARP30159_P050) antibody is Catalog # AAP30159 (Previous Catalog # AAPS08605)
    Datasheets / Downloads:
    Printable datasheet for anti-Ccna2 (ARP30159_P050) antibody

    Customer Reviews for Ccna2 Antibody (ARP30159_P050) tested with testis in Western blot

    CAT# ARP30159_P050

    Ccna2 antibody

    Ccna2 antibody Western Blot

    Ccna2 antibody Testis Extract

    submitted by:
    Sunil Panigrahi
    University of Columbia Medical Center

    Product Protocols: Ccna2 antibody tested with Human Rat Muscle Tissue (ARP30159_P050)

    Aviva Systems Biology is the original manufacturer of this Ccna2 antibody (ARP30159_P050)

    Click here to view the Ccna2 antibody Western Blot Protocol

    Product Datasheet Link: Ccna2 antibody (ARP30159_P050)

    WB Suggested Anti-Ccna2 Antibody Titration: 0.2-1 ug/ml
    ELISA Titer: 1:312500
    Positive Control: Rat Muscle

    Western Blot image:


    Description of Target: The function of Ccna2 remains unknown.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s Ccna2 antibody (ARP30159_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question