website statistics

Aviva Systems Biology

Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

Ccna2 antibody - C-terminal region (ARP30159_P050)

Receive a free blocking peptide (AAP30159) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
The function of Ccna2 remains unknown.
Gene Symbol:
Ccna2
Official Gene Full Name:
Cyclin A2
NCBI Gene Id:
114494
Alias Symbols:
MGC156527; Ccna2
Tissue Tool:
Find tissues and cell lines supported to express Ccna2.
Protein Accession #:
NP_446154
Nucleotide Accession#:
NM_053702
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
418
Molecular Weight:
47kDa
Application:
WB, IHC
Immunogen:
The immunogen for anti-Ccna2 antibody: synthetic peptide corresponding to a region of Rat
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
Ccna2 antibody - C-terminal region (ARP30159_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Yeast: 82%; Zebrafish: 77%
Species Reactivity:
Sheep, Pig, Rabbit, Rat, Bovine, Guinea pig, Human, Dog, Horse, Mouse, Yeast, Zebrafish
Datasheets / Downloads:
Printable datasheet for
anti-Ccna2 antibody
- ARP30159_P050
Peptide Sequence:
Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET
Blocking Peptide:
For anti-Ccna2 antibody is Catalog # AAP30159 (Previous Catalog # AAPS08605)
Key Reference:
N/A
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-Ccna2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question