website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
$289.00
In Stock

Ccna2 antibody - C-terminal region (ARP30159_P050)

Receive a free blocking peptide (AAP30159) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
The function of Ccna2 remains unknown.
Gene Symbol:
Ccna2
Official Gene Full Name:
Cyclin A2
NCBI Gene Id:
114494
Alias Symbols:
MGC156527; Ccna2
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express Ccna2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express Ccna2.
Protein Accession #:
NP_446154
Nucleotide Accession #:
NM_053702
Host:
Rabbit
Clonality:
Polyclonal
Protein Size (# AA):
418
Molecular Weight:
47kDa
Application:
WB, IHC
Immunogen:
The immunogen is a synthetic peptide corresponding to a region of Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Purification:
Affinity Purified
Complete computational species homology data:
Anti-Ccna2 (ARP30159_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 92%; Mouse: 92%; Yeast: 82%; Zebrafish: 77%
Species Reactivity:
Sheep, Pig, Rabbit, Rat, Bovine, Guinea pig, Human, Dog, Horse, Mouse, Yeast, Zebrafish
Datasheets / Downloads:
Printable datasheet for anti-Ccna2 (ARP30159_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: TGYTLESLKPCLMDLHQTYLKAPQHAQQSIREKYKHSKYHSVSLLNPPET
Blocking Peptide:
For anti-Ccna2 (ARP30159_P050) antibody is Catalog # AAP30159 (Previous Catalog # AAPS08605)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Customer Reviews for Ccna2 Antibody (ARP30159_P050) tested with testis in Western blot

CAT# ARP30159_P050

Ccna2 antibody

Ccna2 antibody Western Blot

Ccna2 antibody Testis Extract

submitted by:
Sunil Panigrahi
University of Columbia Medical Center

Product Protocols: Ccna2 antibody tested with Human Rat Muscle Tissue (ARP30159_P050)

Aviva Systems Biology is the original manufacturer of this Ccna2 antibody (ARP30159_P050)

Click here to view the Ccna2 antibody Western Blot Protocol

Product Datasheet Link: Ccna2 antibody (ARP30159_P050)

WB Suggested Anti-Ccna2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Rat Muscle

Western Blot image:


Description of Target: The function of Ccna2 remains unknown.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s Ccna2 antibody (ARP30159_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question