website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

CCK antibody - middle region (ARP33849_P050)

Description of Target:
Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express CCK.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-CCK antibody: synthetic peptide directed towards the middle region of human CCK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
CCK antibody - middle region (ARP33849_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 93%; Horse: 93%; Rat: 92%; Mouse: 92%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79%
Species Reactivity:
Human, Horse, Dog, Rat, Mouse, Bovine, Rabbit, Pig, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-CCK antibody
- ARP33849_P050
Peptide Sequence:
Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Blocking Peptide:
For anti-CCK antibody is Catalog # AAP33849 (Previous Catalog # AAPP04920)
Target Reference:
Lei,Z.M., (2008) HBPD INT 7 (1), 65-69
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Anti-CCK ARP33849_P050 has recently been referenced in the following publications:

Talchai, C., Xuan, S., Kitamura, T., DePinho, R. A. & Accili, D. Generation of functional insulin-producing cells in the gut by Foxo1 ablation. Nat. Genet. 44, 406–12, S1 (2012). IHC, Mouse 22406641

Computational species homology for CCK antibody (ARP33849)

Product page for CCK antibody (ARP33849)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100670232 antibody; Loxodonta africana LOC100670232 antibody G3SZV7 85%
Bovine CCK antibody; Bos taurus CCK antibody F1MC79 85%
Bovine CCKN antibody; Bos taurus CCKN antibody P41520 85%
Chinese hamster LOC100772438 antibody; Cricetulus griseus LOC100772438 antibody G3H992 84%
Crab-eating macaque CCKN antibody; Macaca fascicularis CCKN antibody P23362 92%
Dog CCK antibody; Canis familiaris CCK antibody G1K283 92%
Dog CCKN antibody; Canis familiaris CCKN antibody Q9TS44 92%
Giant panda LOC100477337 antibody; Ailuropoda melanoleuca LOC100477337 antibody D2HN41 92%
Guinea pig LOC100735029 antibody; Cavia porcellus LOC100735029 antibody H0VR95 78%
Horse LOC100055193 antibody; Equus caballus LOC100055193 antibody F7BAG1 92%
Human CCK antibody; Homo sapiens CCK antibody Q6FG82 100%
Human CCKN antibody; Homo sapiens CCKN antibody P06307 100%
Little brown bat CCK antibody; Myotis lucifugus CCK antibody G1P577 78%
Mouse CCKN antibody; Mus musculus CCKN antibody P09240 92%
Northern white-cheeked gibbon LOC100585870 antibody; Nomascus leucogenys LOC100585870 antibody G1R1F4 100%
Pig CCKN antibody; Sus scrofa CCKN antibody P01356 85%
Rabbit LOC100355199 antibody; Oryctolagus cuniculus LOC100355199 antibody G1T9Y3 85%
Rat CCKN antibody; Rattus norvegicus CCKN antibody P01355 92%
Small-eared galago CCK antibody; Otolemur garnettii CCK antibody H0XDC1 85%
Spiny dogfish CCK antibody; Squalus acanthias CCK antibody O42463 90%
White-tufted-ear marmoset LOC100396125 antibody; Callithrix jacchus LOC100396125 antibody F6QGZ9 100%

Product Protocols: CCK antibody tested with Human Fetal Brain Tissue (ARP33849_P050)

Aviva Systems Biology is the original manufacturer of this CCK antibody (ARP33849_P050)

Click here to view the CCK antibody Western Blot Protocol

Product Datasheet Link: CCK antibody (ARP33849_P050)

WB Suggested Anti-CCK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Brain

Western Blot image:

Description of Target: Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CCK antibody (ARP33849_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question