website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

US

CCK antibody - middle region (ARP33849_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
$289.00
In Stock
Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CCK
NCBI Gene Id:
885
Official Gene Full Name:
Cholecystokinin
Protein Name:
Cholecystokinin
Swissprot Id:
P06307
Protein Accession #:
NP_000720
Nucleotide Accession #:
NM_000729
Alias Symbols:
MGC117187
Description of Target:
Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
115
Molecular Weight:
13kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCK.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human CCK
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 92%
Complete computational species homology data:
Anti-CCK (ARP33849_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
UBC; CCKBR; CCKAR; CPE; ENPEP; MEP1B; MEP1A;
Blocking Peptide:
For anti-CCK (ARP33849_P050) antibody is Catalog # AAP33849 (Previous Catalog # AAPP04920)
Datasheets / Downloads:
Printable datasheet for anti-CCK (ARP33849_P050) antibody
Target Reference:
Lei,Z.M., (2008) HBPD INT 7 (1), 65-69
Publications:

Talchai, C., Xuan, S., Kitamura, T., DePinho, R. A. & Accili, D. Generation of functional insulin-producing cells in the gut by Foxo1 ablation. Nat. Genet. 44, 406-12, S1 (2012). IHC, Human, Horse, Dog, Rat, Mouse, Bovine, Rabbit, Pig, Guinea pig 22406641

Product Protocols: CCK antibody tested with Human Fetal Brain Tissue (ARP33849_P050)

Aviva Systems Biology is the original manufacturer of this CCK antibody (ARP33849_P050)

Click here to view the CCK antibody Western Blot Protocol

Product Datasheet Link: CCK antibody (ARP33849_P050)

WB Suggested Anti-CCK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Brain

Western Blot image:


Description of Target: Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s CCK antibody (ARP33849_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

 
X
Ask a Question