website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

CCK antibody - middle region (ARP33849_P050)

Publications:

Anti-CCK ARP33849_P050 has recently been referenced in the following publications:

Talchai, C., Xuan, S., Kitamura, T., DePinho, R. A. & Accili, D. Generation of functional insulin-producing cells in the gut by Foxo1 ablation. Nat. Genet. 44, 406–12, S1 (2012). IHC, Mouse 22406641

Description of Target:
Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
CCK
Official Gene Full Name:
Cholecystokinin
NCBI Gene Id:
885
Alias Symbols:
MGC117187
Tissue Tool:
Find tissues and cell lines supported to express CCK.
Protein Accession #:
NP_000720
Nucleotide Accession#:
NM_000729
Swissprot Id:
P06307
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Cholecystokinin
Protein Size (# AA):
115
Molecular Weight:
13kDa
Application:
WB
Partner Proteins:
CLPS
Immunogen:
The immunogen for anti-CCK antibody: synthetic peptide directed towards the middle region of human CCK
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
CCK antibody - middle region (ARP33849_P050)
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Dog: 93%; Horse: 93%; Rat: 92%; Mouse: 92%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79%
Species Reactivity:
Human, Horse, Dog, Rat, Mouse, Bovine, Rabbit, Pig, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-CCK antibody
- ARP33849_P050
Peptide Sequence:
Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Blocking Peptide:
For anti-CCK antibody is Catalog # AAP33849 (Previous Catalog # AAPP04920)
Key Reference:
Lei,Z.M., (2008) HBPD INT 7 (1), 65-69
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CCK antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question