website statistics
Account Login 

Now Offering Over 102,157 Antibodies & 44,722 Antigens!

CCK antibody - middle region (ARP33849_P050)

Scroll Horizontally to view all Images
Print Page
  • Let us Help: Ask a Question
100 ul

Regular Price: $289.00

Special Price: $235.00

In Stock

Conjugation Options

ARP33849_P050-FITC Conjugated

ARP33849_P050-HRP Conjugated

ARP33849_P050-Biotin Conjugated

Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Replacement Item:
This antibody may replace item sc-20937 from Santa Cruz Biotechnology.
Description of Target:
Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CCK.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CCK.
The immunogen is a synthetic peptide directed towards the middle region of human CCK
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 86%; Rabbit: 86%; Rat: 92%
Complete computational species homology data:
Anti-CCK (ARP33849_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-CCK (ARP33849_P050) antibody is Catalog # AAP33849 (Previous Catalog # AAPP04920)
Datasheets / Downloads:
Printable datasheet for anti-CCK (ARP33849_P050) antibody
Target Reference:
Lei,Z.M., (2008) HBPD INT 7 (1), 65-69

Talchai, C., Xuan, S., Kitamura, T., DePinho, R. A. & Accili, D. Generation of functional insulin-producing cells in the gut by Foxo1 ablation. Nat. Genet. 44, 406-12, S1 (2012). IHC, Human, Horse, Dog, Rat, Mouse, Bovine, Rabbit, Pig, Guinea pig 22406641

Product Protocols: CCK antibody tested with Human Fetal Brain Tissue (ARP33849_P050)

Aviva Systems Biology is the original manufacturer of this CCK antibody (ARP33849_P050)

Click here to view the CCK antibody Western Blot Protocol

Product Datasheet Link: CCK antibody (ARP33849_P050)

WB Suggested Anti-CCK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Fetal Brain

Western Blot image:

Description of Target: Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.Cholecystokinin is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CCK antibody (ARP33849_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question