CCDC68 Antibody - middle region (ARP62778_P050)

Catalog No: ARP62778_P050

WB Suggested Anti-CCDC68 Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Cow, Dog
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 90%; Dog: 77%; Human: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: EAGAAALRNVAQRLFENYQTQSEEVRKKQEDSKQLLQVNKLEKEQKLKQH
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CCDC68 (ARP62778_P050) antibody is Catalog # AAP62778

Target Info

• Gene Symbol: CCDC68
• Gene Full Name: Coiled-coil domain containing 68
• Alias Symbols: SE57-1
• NCBI Gene Id: 80323
• Protein Name: Coiled-coil domain-containing protein 68
• Description of Target: The function of this protein remains unknown.
• Uniprot ID: Q9H2F9
• Protein Accession #: NP_079490
• Nucleotide Accession #: NM_025214
• Protein Size (# AA): 335
• Molecular Weight: 37kDa
• Protein Interactions: TFIP11; RPS21; RPSA;