CBR1 Antibody - middle region (ARP45800_P050)

Catalog No: ARP45800_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-CBR1 Antibody Titration: 0.2-1 ug/ml
Positive Control: OVCAR-3 cell lysateCBR1 is supported by BioGPS gene expression data to be expressed in OVCAR3

Rabbit Anti-CBR1 Antibody
Catalog Number: ARP45800_P050
Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue
Observed Staining: Cytoplasmic
Primary Antibody Concentration: N/A
Other Working Concentrations: 1:600
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CBR1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 79%; Rat: 93%; Zebrafish: 79%
• Peptide Sequence: Synthetic peptide located within the following region: AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CBR1 (ARP45800_P050) antibody is Catalog # AAP45800 (Previous Catalog # AAPP26744)
• Sample Type Confirmation:

  CBR1 is supported by BioGPS gene expression data to be expressed in OVCAR3

• Publications:

  Lim, S. et al. Carbonyl reductase 1 is an essential regulator of skeletal muscle differentiation and regeneration. Int. J. Biochem. Cell Biol. 45, 1784-93 (2013). 23732109

  Mitani, T. et al. Resveratrol reduces the hypoxia-induced resistance to doxorubicin in breast cancer cells. J. Nutr. Sci. Vitaminol. (Tokyo). 60, 122-8 (2014). 24975222

Target Info

• Gene Symbol: CBR1
• Gene Full Name: Carbonyl reductase 1
• Alias Symbols: CBR, hCBR1, PG-9-KR, SDR21C1
• NCBI Gene Id: 873
• Protein Name: Carbonyl reductase [NADPH] 1
• Description of Target: Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.
• Uniprot ID: P16152
• Protein Accession #: NP_001748
• Nucleotide Accession #: NM_001757
• Protein Size (# AA): 277
• Molecular Weight: 30kDa
• Protein Interactions: MDM2; GRB2; VHL; ESR1; UBC; COPS5; CUL1; UL27; RAD21; Mapk13; UBA5; DDA1; ATG101; PRKAB1; EGFR; ERCC8; MCC;