- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for CASPASE Antibody (OABB01852) |
---|
Tested Species Reactivity | Human, Rat |
---|---|
Predicted Species Reactivity | Human|Rat |
Product Format | Lyophilized. Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4. |
Clonality | Polyclonal |
Clone | Polyclonal |
Isotype | Rabbit IgG |
Host | Rabbit |
Application | Immunohistochemistry|Western blot |
Additional Information | Notes: WB: The detection limit for Caspase-7 is approximately 0.1ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. |
:: | Background: CASP7, Caspase-7, apoptosis-related cysteine peptidase, is a human protein encoded by the CASP7 gene. CASP7 orthologs have been identified in nearly all mammals for which complete genome data are available. CASP7 is a member of the caspase (cysteine aspartate protease) family of proteins, and has been shown to be an executioner protein of apoptosis. Using radiation hybrid mapping, the CASP7 gene was localized to human chromosome 10q25.1-q25.2. The orderly activation of CASP7 regulates microglia activation through a protein kinase C-delta (PRKCD)-dependent pathway. |
Reconstitution and Storage | 2°C to 8°C|-20°C |
Immunogen | E.coli-derived human CASP7 recombinant protein (Position: A117-D198). Human CASP7 shares 92.7% amino acid (aa) sequence identity with both mouse and rat CASP7. |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: AKMQDLLKKASEEDHTNAACFACILLSHGEENVIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKLFFIQACRGTELDDGIQAD |
Concentration | 500 ug/ml |
Specificity | No cross reactivity with other proteins. |
Application Info | Western blot: 0.1-0.5 ug/ml: Human, Rat Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human: By Heat |
Reference | 1. Burguillos, M. A., Deierborg, T., Kavanagh, E., Persson, A., Hajji, N., Garcia-Quintanilla, A., Cano, J., Brundin, P., Englund, E., Venero, J. L., Joseph, B. Caspase signalling controls microglia activation and neurotoxicity. Nature 472: 319-324, 2011. 2. Soung, Y. H., Lee, J. W., Kim, H. S., Park, W. S., Kim, S. Y., Lee, J. H., Park, J. Y., Cho, Y. G., Kim, C. J., Park, Y. G., Nam, S. W., Jeong, S. W., Kim, S. H., Lee, J. Y., Yoo, N. J., Lee, S. H. Inactivating mutations of CASPASE-7 gene in human cancers. Oncogene 22: 8048-8052, 2003. 3. Tiso, N., Pallavicini, A., Muraro, T., Zimbello, R., Apolloni, E., Valle, G., Lanfranchi, G., Danieli, G. A. Chromosomal localization of the human genes, CPP32, Mch2, Mch3, and Ich-1, involved in cellular apoptosis. Biochem. Biophys. Res. Commun. 225: 983-989, 1996. |
Storage Buffer | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Description | Rabbit IgG polyclonal antibody for Caspase-7(CASP7) detection. Tested with WB, IHC-P in Human;Rat. |
Gene Symbol | CASP7 |
---|---|
Gene Full Name | caspase 7 |
Alias Symbols | apoptotic protease MCH-3;CASP-7;caspase 7, apoptosis-related cysteine peptidase;caspase 7, apoptosis-related cysteine protease;caspase-7;CMH-1;ICE-LAP3;ICE-like apoptotic protease 3;LICE2;MCH3. |
NCBI Gene Id | 840 |
Protein Name | Caspase-7 |
Description of Target | Involved in the activation cascade of caspases responsible for apoptosis execution. Cleaves and activates sterol regulatory element binding proteins (SREBPs). Proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at a '216-Asp-|-Gly-217' bond. Overexpression promotes programmed cell death. |
Uniprot ID | P55210 |
Molecular Weight | 34277 MW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "CASPASE Antibody (OABB01852)"?
The tested species reactivity for this item is "Human, Rat". This antibody is predicted to have homology to "Human|Rat".
-
How long will it take to receive "CASPASE Antibody (OABB01852)"?
This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".
-
What buffer format is "CASPASE Antibody (OABB01852)" provided in?
This item is provided in "Lyophilized. Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "CASPASE Antibody (OABB01852)"?
This target may also be called "apoptotic protease MCH-3;CASP-7;caspase 7, apoptosis-related cysteine peptidase;caspase 7, apoptosis-related cysteine protease;caspase-7;CMH-1;ICE-LAP3;ICE-like apoptotic protease 3;LICE2;MCH3." in publications.
-
What is the shipping cost for "CASPASE Antibody (OABB01852)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "CASPASE Antibody (OABB01852)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "CASPASE Antibody (OABB01852)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "34277 MW".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "CASPASE Antibody (OABB01852)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "CASP7"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "CASP7"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "CASP7"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "CASP7"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "CASP7"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "CASP7"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.