CAMK2B Antibody - C-terminal region (ARP61268_P050)

Catalog No: ARP61268_P050

WB Suggested Anti-CAMK2B Antibody
Titration: 1.0 ug/ml
Positive Control: Fetal Heart

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CAMK2B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: NPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-CAMK2B (ARP61268_P050) antibody is Catalog # AAP61268 (Previous Catalog # AAPP47411)
• Subunit: beta

Target Info

• Gene Symbol: CAMK2B
• Gene Full Name: Calcium/calmodulin-dependent protein kinase II beta
• Alias Symbols: CAM2, CAMK2, CAMKB, MRD54, CaMKIIbeta
• NCBI Gene Id: 816
• Protein Name: Calcium/calmodulin-dependent protein kinase IIB isoform 2 variant EMBL BAD96423.1
• Description of Target: The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Eight transcript variants encoding eight distinct isoforms have been identified for this gene.
• Uniprot ID: Q53H78
• Protein Accession #: NP_742075
• Nucleotide Accession #: NM_172078
• Protein Size (# AA): 542
• Molecular Weight: 60kDa
• Protein Interactions: KRTAP10-11; KRTAP19-7; KRTAP19-5; FAM171A2; MGAT5B; CCM2L; TTC5; AP5B1; MRPL11; SEMA4G; SPRYD7; MED18; POP5; RBFOX2; ACOT7; RBPMS; MORF4L1; MAD2L2; RPL11; RAP2B; PHKB; CAMK2B; MVP; SMYD3; UBC; ATXN1; HSP90AA1; Rad23a; THRB; RXRG; YWHAB; CAMK2N2; CAMK2D; A