website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

cad antibody - middle region (ARP47825_P050)

Description of Target:
Cad regulates embryonic abdominal segment formation by zygotically activating expression of knirps (kni) and giant (gt). It plays a role in the establishment of the hindgut and in the invagination of the hindgut primordium during gastrulation. These effects on the gut are achieved by acting combinatorially at the posterior of the embryo to activate transcription of different targets, including folded gastrulation (fog), fork head (fkh) and wingless (wg).
Gene Symbol:
Official Gene Full Name:
NCBI Gene Id:
Alias Symbols:
Dmel_CG1759; 38E.19; CG1759; Cad; S67; cd; anon-WO2004063362.83; CAD; Dmel\CG1759
Tissue Tool:
Find tissues and cell lines supported to express cad.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Homeotic protein caudal
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
CG1418; CG32647; CG34168; CkIIalpha; RpS7; CG31140; lsn; CG10032; CG6933; Cp16; CG2199; Khc; CG15706; CG13339; Ef1alpha48D; CG14764; noc; CG44774;
The immunogen for anti-cad antibody: synthetic peptide corresponding to a region of Fruit fly
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
cad antibody - middle region (ARP47825_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Species Reactivity:
Zebrafish, Bovine, Pig, Dog, Rat, Horse, Rabbit, Guinea pig, Mouse, Human
Datasheets / Downloads:
Printable datasheet for
anti-cad antibody
- ARP47825_P050
Peptide Sequence:
Synthetic peptide located within the following region: SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE
Blocking Peptide:
For anti-cad antibody is Catalog # AAP47825 (Previous Catalog # AAPS19005)
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for cad antibody (ARP47825)

Product page for cad antibody (ARP47825)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Acorn worm cdx antibody; Saccoglossus kowalevskii cdx antibody B5B3S6 91%
African clawed frog CDX1 antibody; Xenopus laevis CDX1 antibody Q91622 100%
African clawed frog cdx2 antibody; Xenopus laevis cdx2 antibody Q2T9K7 76%
African clawed frog Xcad 2 antibody; Xenopus laevis Xcad 2 antibody Q03922 100%
African clawed frog xCAD2 antibody; Xenopus laevis xCAD2 antibody A6H8J8 100%
African elephant LOC100671525 antibody; Loxodonta africana LOC100671525 antibody G3TV73 100%
African malaria mosquito cad antibody; Anopheles gambiae cad antibody Q9XYQ3 92%
Balanoglossus simodensis BsimCdx antibody C6L7V7 100%
Bornean orangutan CDX1 antibody; Pongo pygmaeus CDX1 antibody A2T7H5 100%
Bovine CDX1 antibody; Bos taurus CDX1 antibody F1MCF6 100%
Bovine CDX1 antibody; Bos taurus CDX1 antibody A6QLL3 100%
Brine shrimp cad antibody; Artemia franciscana cad antibody Q70LF3 91%
Capitella teleta Cdx antibody Q2FBJ0 100%
Chicken CDX1 antibody; Gallus gallus CDX1 antibody Q9DEB6 100%
Chicken CDX1 antibody; Gallus gallus CDX1 antibody Q6LBJ7 100%
Chicken CDX1 antibody; Gallus gallus CDX1 antibody F6R243 100%
Chicken HMD1 antibody; Gallus gallus HMD1 antibody P46692 100%
Common limpet cdx antibody; Patella vulgata cdx antibody Q8I757 84%
Common turkey LOC100549688 antibody; Meleagris gallopavo LOC100549688 antibody G1N4V0 100%
Desert locust cad antibody; Schistocerca gregaria cad antibody Q95W39 100%
Diplosoma listerianum cdx antibody Q7Z1M7 85%
Dog CDX1 antibody; Canis familiaris CDX1 antibody E2RKQ8 100%
Duckbill platypus CDX1 antibody; Ornithorhynchus anatinus CDX1 antibody F7AKJ5 100%
Dumeril clam worm cad antibody; Platynereis dumerilii cad antibody Q3LRS0 84%
Empis livida cad antibody A9YU93 92%
Fruit fly CAD antibody; Drosophila melanogaster CAD antibody P09085 100%
Fruit fly cad antibody; Drosophila melanogaster cad antibody A4V0Y1 100%
Fruit fly DmojGI17922 antibody; Drosophila mojavensis DmojGI17922 antibody B4KEC9 100%
Fruit fly DperGL18519 antibody; Drosophila persimilis DperGL18519 antibody B4G734 100%
Fruit fly DpseGA14567 antibody; Drosophila pseudoobscura pseudoobscura DpseGA14567 antibody Q29LX3 100%
Fruit fly DwilGK14914 antibody; Drosophila willistoni DwilGK14914 antibody B4MWB4 100%
Gray short-tailed opossum LOC100024158 antibody; Monodelphis domestica LOC100024158 antibody F6XTN5 100%
Green anole CDX1 antibody; Anolis carolinensis CDX1 antibody G1KQZ7 100%
Guinea pig CDX1 antibody; Cavia porcellus CDX1 antibody H0W0R3 100%
Honeybee cad antibody; Apis mellifera cad antibody G8FU58 92%
Horse LOC100071660 antibody; Equus caballus LOC100071660 antibody F6SI65 100%
House spider At.cad antibody; Parasteatoda tepidariorum At.cad antibody Q869A1 85%
Human CDX1 antibody; Homo sapiens CDX1 antibody P47902 100%
Human CDX1 antibody; Homo sapiens CDX1 antibody P47902-2 100%
Human CDX1 antibody; Homo sapiens CDX1 antibody Q4VAU3 100%
Human CDX1 antibody; Homo sapiens CDX1 antibody G8JLG9 100%
Humpbacked fly cad antibody; Megaselia abdita cad antibody A9YU98 100%
Humpbacked fly cad antibody; Megaselia abdita cad antibody A9YU96 100%
Humpbacked fly cad antibody; Megaselia abdita cad antibody A9YU97 92%
Little brown bat CDX1 antibody; Myotis lucifugus CDX1 antibody G1PBH6 100%
Lonchoptera lutea cad antibody A9YU92 92%
Lowland gorilla ENSG00000113722 antibody; Gorilla gorilla gorilla ENSG00000113722 antibody G3QD01 85%
Marmalade hoverfly cad antibody; Episyrphus balteatus cad antibody B8XJD7 92%
Mouse CDX1 antibody; Mus musculus CDX1 antibody P18111 100%
Northern white-cheeked gibbon LOC100590760 antibody; Nomascus leucogenys LOC100590760 antibody G1RH01 100%
Pig LOC100626275 antibody; Sus scrofa LOC100626275 antibody F1RL72 100%
Rabbit CDX1 antibody; Oryctolagus cuniculus CDX1 antibody G1T3E3 100%
Rat Cdx1 antibody; Rattus norvegicus Cdx1 antibody F1LR94 100%
Red flour beetle Cad antibody; Tribolium castaneum Cad antibody O96714 100%
Red flour beetle caudal-1 antibody; Tribolium castaneum caudal-1 antibody D2A357 100%
Rhesus macaque CDX1 antibody; Macaca mulatta CDX1 antibody F7BTG4 100%
Sea squirt Hrcad antibody; Halocynthia roretzi Hrcad antibody Q9U8Q3 92%
Silk moth cad-like antibody; Bombyx mori cad-like antibody Q17243 92%
Small-eared galago CDX1 antibody; Otolemur garnettii CDX1 antibody H0Y2D5 100%
Symsagittifera roscoffensis Cdx antibody Q7Z0F2 100%
Three-spined stickleback CDX1 (2 of 2) antibody; Gasterosteus aculeatus CDX1 (2 of 2) antibody G3NAG6 100%
Transparent sea squirt cdx antibody; Ciona intestinalis cdx antibody Q4H3T1 91%
Transparent sea squirt CI-CDX antibody; Ciona intestinalis CI-CDX antibody F6YJR3 91%
Two-spotted cricket cad antibody; Gryllus bimaculatus cad antibody Q60FK2 100%
Water flea CAD antibody; Daphnia pulex CAD antibody E9G1U5 100%
Western clawed frog CDX1 antibody; Xenopus tropicalis CDX1 antibody Q90X89 100%
Western clawed frog cdx1 antibody; Xenopus tropicalis cdx1 antibody Q07G97 100%
Western clawed frog cdx1 antibody; Xenopus tropicalis cdx1 antibody F6ZM30 100%
Western clawed frog cdx1 antibody; Xenopus tropicalis cdx1 antibody B7ZUR8 100%
White-tufted-ear marmoset LOC100390212 antibody; Callithrix jacchus LOC100390212 antibody F7G6D7 100%
White-tufted-ear marmoset LOC100390212 antibody; Callithrix jacchus LOC100390212 antibody F7BAN1 100%
Zebrafish cdx1a antibody; Danio rerio cdx1a antibody Q8AXR4 100%
Zebrafish cdx1a antibody; Danio rerio cdx1a antibody F1QZG5 100%
Zebrafish cdx1b antibody; Danio rerio cdx1b antibody A5PLE8 100%

Product Protocols: cad antibody tested with Human Drosophila (ARP47825_P050)

Aviva Systems Biology is the original manufacturer of this cad antibody (ARP47825_P050)

Click here to view the cad antibody Western Blot Protocol

Product Datasheet Link: cad antibody (ARP47825_P050)

WB Suggested Anti-cad Antibody Titration: 0.2-1 ug/ml
Positive Control: Drosophila

Western Blot image:

Description of Target: Cad regulates embryonic abdominal segment formation by zygotically activating expression of knirps (kni) and giant (gt). It plays a role in the establishment of the hindgut and in the invagination of the hindgut primordium during gastrulation. These effects on the gut are achieved by acting combinatorially at the posterior of the embryo to activate transcription of different targets, including folded gastrulation (fog), fork head (fkh) and wingless (wg).

Questions pertaining to this data can be directed to

Aviva Systems Biology’s cad antibody (ARP47825_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question