website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

CAD antibody - C-terminal region (ARP46104_P050)

Description of Target:
CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.The de novo synthesis of pyrimidine nucleotides is required for mammalian cells to proliferate. This gene encodes a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express CAD.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
CAD protein
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
The immunogen for anti-CAD antibody: synthetic peptide directed towards the C terminal of human CAD
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
CAD antibody - C-terminal region (ARP46104_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Guinea pig: 93%; Yeast: 92%
Species Reactivity:
Mouse, Rat, Dog, Bovine, Zebrafish, Horse, Human, Rabbit, Guinea pig, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-CAD antibody
- ARP46104_P050
Peptide Sequence:
Synthetic peptide located within the following region: ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL
Blocking Peptide:
For anti-CAD antibody is Catalog # AAP46104 (Previous Catalog # AAPP26966)
Key Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-CAD antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question