website statistics
Account Login 

Aviva Systems Biology office will be closed for Independence Day - 7/3/2015.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

CAD antibody - C-terminal region (ARP46104_P050)

Description of Target:
CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.The de novo synthesis of pyrimidine nucleotides is required for mammalian cells to proliferate. This gene encodes a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express CAD.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express CAD.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Name:
CAD protein
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen is a synthetic peptide directed towards the C terminal region of human CAD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Affinity Purified
Complete computational species homology data:
Anti-CAD (ARP46104_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Guinea pig: 93%; Yeast: 92%
Species Reactivity:
Mouse, Rat, Dog, Bovine, Zebrafish, Horse, Human, Rabbit, Guinea pig, Yeast
Datasheets / Downloads:
Printable datasheet for anti-CAD (ARP46104_P050) antibody
Peptide Sequence:
Synthetic peptide located within the following region: ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL
Blocking Peptide:
For anti-CAD (ARP46104_P050) antibody is Catalog # AAP46104 (Previous Catalog # AAPP26966)
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Product Protocols: CAD antibody tested with Human Fetal Lung Tissue (ARP46104_P050)

Aviva Systems Biology is the original manufacturer of this CAD antibody (ARP46104_P050)

Click here to view the CAD antibody Western Blot Protocol

Product Datasheet Link: CAD antibody (ARP46104_P050)

WB Suggested Anti-CAD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Lung

Western Blot image:

Description of Target: CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.The de novo synthesis of pyrimidine nucleotides is required for mammalian cells to proliferate. This gene encodes a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CAD antibody (ARP46104_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question