website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

CAD antibody - C-terminal region (ARP46104_P050)

Description of Target:
CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.The de novo synthesis of pyrimidine nucleotides is required for mammalian cells to proliferate. This gene encodes a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase
NCBI Gene Id:
Alias Symbols:
Tissue Tool:
Find tissues and cell lines supported to express CAD.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
CAD protein
Protein Size (# AA):
Molecular Weight:
Protein Interactions:
The immunogen for anti-CAD antibody: synthetic peptide directed towards the C terminal of human CAD
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Affinity Purified
Complete computational species homology data:
CAD antibody - C-terminal region (ARP46104_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Guinea pig: 93%; Yeast: 92%
Species Reactivity:
Mouse, Rat, Dog, Bovine, Zebrafish, Horse, Human, Rabbit, Guinea pig, Yeast
Datasheets / Downloads:
Printable datasheet for
anti-CAD antibody
- ARP46104_P050
Peptide Sequence:
Synthetic peptide located within the following region: ADVVVLRHPQPGAVELAAKHCRRPVINAGDGVGEHPTQALLDIFTIREEL
Blocking Peptide:
For anti-CAD antibody is Catalog # AAP46104 (Previous Catalog # AAPP26966)
Target Reference:
Olsen,J.V., (2006) Cell 127 (3), 635-648
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Computational species homology for CAD antibody (ARP46104)

Product page for CAD antibody (ARP46104)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant CAD antibody; Loxodonta africana CAD antibody G3T932 100%
Bovine CAD antibody; Bos taurus CAD antibody F1MVC0 100%
Brown alga putative antibody; Ectocarpus siliculosus putative antibody D7G203 92%
Cardiobacterium hominis ATCC 15826 pyrB antibody C8NBK3 91%
Cardiobacterium valvarum F0432 pyrB antibody G9ZH51 91%
Chinese hamster Cad antibody; Cricetulus griseus Cad antibody G3GXT2 100%
Chlorobium tepidum PYRB antibody Q8KBI7 84%
Dog CAD antibody; Canis familiaris CAD antibody E2RAV2 100%
Duckbill platypus CAD antibody; Ornithorhynchus anatinus CAD antibody F6UXD3 100%
Fruit fly DanaGF21836 antibody; Drosophila ananassae DanaGF21836 antibody B3N0F3 85%
Fruit fly DereGG19065 antibody; Drosophila erecta DereGG19065 antibody B3NVK4 92%
Fruit fly DgriGH12789 antibody; Drosophila grimshawi DgriGH12789 antibody B4JL50 85%
Fruit fly DmojGI15230 antibody; Drosophila mojavensis DmojGI15230 antibody B4L1V5 85%
Fruit fly DperGL20254 antibody; Drosophila persimilis DperGL20254 antibody B4GXJ3 92%
Fruit fly DpseGA14996 antibody; Drosophila pseudoobscura pseudoobscura DpseGA14996 antibody Q29HK5 92%
Fruit fly Dsimr antibody; Drosophila simulans Dsimr antibody B4NUJ8 85%
Fruit fly DvirGJ18689 antibody; Drosophila virilis DvirGJ18689 antibody B4M2B0 85%
Fruit fly DwilGK19926 antibody; Drosophila willistoni DwilGK19926 antibody B4MSD0 85%
Fruit fly DyakGE17287 antibody; Drosophila yakuba DyakGE17287 antibody B4PXW0 85%
Fruit fly PYR1 antibody; Drosophila melanogaster PYR1 antibody P05990 85%
Giant panda CAD antibody; Ailuropoda melanoleuca CAD antibody G1L4R0 100%
Golden hamster PYR1 antibody; Mesocricetus auratus PYR1 antibody P08955 100%
Gray short-tailed opossum CAD antibody; Monodelphis domestica CAD antibody F7E0R2 100%
Guinea pig CAD antibody; Cavia porcellus CAD antibody H0V1S3 92%
Horse CAD antibody; Equus caballus CAD antibody F6U768 100%
Human CAD antibody; Homo sapiens CAD antibody Q96CK3 100%
Human CAD antibody; Homo sapiens CAD antibody Q53SY7 100%
Human CAD antibody; Homo sapiens CAD antibody F8VPD4 100%
Human PYR1 antibody; Homo sapiens PYR1 antibody P27708 100%
Hydra magnipapillata CAD antibody E2JE28 100%
Leptospira interrogans serovar Lai str. IPAV pyrB antibody G7QLZ3 83%
Little brown bat CAD antibody; Myotis lucifugus CAD antibody G1NVK1 100%
Lowland gorilla CAD antibody; Gorilla gorilla gorilla CAD antibody G3R7L6 100%
Marine diatom PYR antibody; Thalassiosira pseudonana PYR antibody B8C5Q8 100%
Methanobrevibacter smithii DSM 2374 pyrB antibody D2ZNW8 83%
Methanobrevibacter smithii DSM 2375 pyrB antibody B9AFQ4 83%
Methanolinea tarda NOBI-1 pyrB antibody G6FKM7 83%
Mouse Cad antibody; Mus musculus Cad antibody Q9CWQ9 100%
Mouse Cad antibody; Mus musculus Cad antibody Q80VF8 100%
Mouse Cad antibody; Mus musculus Cad antibody G3UWN2 100%
Mouse Cad antibody; Mus musculus Cad antibody E9QAI5 100%
Mouse Cad antibody; Mus musculus Cad antibody B7ZN27 100%
Mouse Cad antibody; Mus musculus Cad antibody B2RQC6 100%
Mouse-ear cress PYRB antibody; Arabidopsis thaliana PYRB antibody P49077 91%
Mouse-ear cress PYRB antibody; Arabidopsis thaliana PYRB antibody Q683J9 91%
Northern white-cheeked gibbon CAD antibody; Nomascus leucogenys CAD antibody G1QSG4 100%
PBCV-1 A169R antibody; Paramecium bursaria Chlorella virus 1 A169R antibody Q84489 83%
Prairie vole CAD antibody; Microtus ochrogaster CAD antibody E0V860 100%
Rabbit CAD antibody; Oryctolagus cuniculus CAD antibody G1TCT3 100%
Rat Cad antibody; Rattus norvegicus Cad antibody D4A8A0 100%
Red flour beetle LOC660900 antibody; Tribolium castaneum LOC660900 antibody D6X207 85%
Slime mold PYR1 antibody; Dictyostelium discoideum PYR1 antibody P20054 91%
Small-eared galago CAD antibody; Otolemur garnettii CAD antibody H0XGD3 92%
Spiny dogfish PYR1 antibody; Squalus acanthias PYR1 antibody Q91437 85%
strain 56601 PYRB antibody; Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai PYRB antibody Q8F812 83%
strain AL-21 pyrB antibody; Methanobacterium sp. pyrB antibody F0T7D3 83%
strain ATCC 35101 / DSM 1498 / JR1 PYRB antibody; Methanoculleus marisnigri PYRB antibody A3CW66 83%
strain ATCC 43054 / DSM 2088 / JCM 10308 / V24 S pyrB antibody; Methanothermus fervidus pyrB antibody E3GWJ4 83%
strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126 PYRB antibody; Archaeoglobus fulgidus PYRB antibody O30130 83%
strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828 PYRB antibody; Picrophilus torridus PYRB antibody Q6L0F2 92%
strain ATCC 700274 / DSM 11551 / JCM 10706 / PR3 pyrB antibody; Halogeometricum borinquense pyrB antibody E4NMT9 83%
strain ATCC 700841 / DSM 12885 / JCM 10246 / 7p75a pyrB antibody; Thermaerobacter marianensis pyrB antibody E6SJH8 91%
strain ATCC 9614 / CIP 103027 / CIRM-BIA1 pyrB antibody; Propionibacterium freudenreichii subsp. shermanii pyrB antibody D7GFE2 91%
strain ATCC BAA-1556 / DSM 19958 / E1-9c PYRB antibody; Methanosphaerula palustris PYRB antibody B8GF03 83%
strain CaD3 PYRB antibody; Chlorobium chlorochromatii PYRB antibody Q3AQY1 76%
strain Delta H PYRB antibody; Methanobacterium thermoautotrophicum PYRB antibody O27464 83%
strain DSM 10642 / AEDII12DO pyrB antibody; Ferroglobus placidus pyrB antibody D3S168 83%
strain DSM 11195 / SNP6 pyrB antibody; Archaeoglobus veneficus pyrB antibody F2KTB5 83%
strain DSM 11571 / OCM 486 / SEBR 4847 pyrB antibody; Methanoplanus petrolearius pyrB antibody E1RJQ8 83%
strain DSM 16790 PYRB antibody; Haloquadratum walsbyi PYRB antibody Q18J05 83%
strain DSM 16854 / JCM 12705 / C23 pyrB antibody; Haloquadratum walsbyi pyrB antibody G0LKH2 83%
strain DSM 19572 / T469 pyrB1 antibody; Aciduliprofundum boonei pyrB1 antibody B5IFK3 83%
strain DSM 19572 / T469 pyrB2 antibody; Aciduliprofundum boonei pyrB2 antibody B5IFV6 83%
strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg pyrB antibody; Methanothermobacter marburgensis pyrB antibody D9PYR9 83%
strain DSM 2160 / ATCC 35678 PYRB antibody; Natronomonas pharaonis PYRB antibody Q3IPU8 83%
strain DSM 2912 / NBRC 15312 / T2 pyrB antibody; Bacillus tusciae pyrB antibody D5WXZ9 91%
strain DSM 3091 PYRB antibody; Methanosphaera stadtmanae PYRB antibody Q2NIC0 83%
strain DSM 4017 / NBRC 107636 / OCM 62 / WeN5 pyrB antibody; Methanosalsum zhilinae pyrB antibody F7XNZ6 83%
strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18 pyrB antibody; Archaeoglobus profundus pyrB antibody D2RDI2 83%
strain Fiocruz L1-130 PYRB antibody; Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni PYRB antibody Q72NJ5 83%
strain NCIB 8327 PYRB antibody; Chlorobaculum parvum PYRB antibody B3QQ34 84%
strain Patoc 1 / Ames PYRB antibody; Leptospira biflexa serovar Patoc PYRB antibody B0SEH6 83%
strain Patoc 1 / ATCC 23582 / Paris PYRB antibody; Leptospira biflexa serovar Patoc PYRB antibody B0SMK5 83%
strain PS / ATCC 35061 / DSM 861 PYRB antibody; Methanobrevibacter smithii PYRB antibody A5UMP0 83%
strain RCC307 pyrB antibody; Synechococcus sp. pyrB antibody A5GT19 75%
strain SH3 pyr1-3 antibody; Dictyostelium fasciculatum pyr1-3 antibody F4PJS2 91%
strain SWAN-1 pyrB antibody; Methanobacterium sp. pyrB antibody F6D6H2 83%
strain TW08/27 pyrB antibody; Tropheryma whipplei pyrB antibody Q83HI3 91%
strain Twist pyrB antibody; Tropheryma whipplei pyrB antibody Q83GQ3 91%
strain VCS1703A PYRB antibody; Dichelobacter nodosus PYRB antibody A5EVP6 91%
Tasmanian devil CAD antibody; Sarcophilus harrisii CAD antibody G3WH49 100%
Thermaerobacter subterraneus DSM 13965 pyrB antibody E4M5T6 91%
Three-spined stickleback CAD antibody; Gasterosteus aculeatus CAD antibody G3NRT1 92%
Three-spined stickleback CAD antibody; Gasterosteus aculeatus CAD antibody G3NRS1 92%
Western clawed frog cad antibody; Xenopus tropicalis cad antibody F7D2L7 92%
Western clawed frog cad antibody; Xenopus tropicalis cad antibody F7CX88 92%
Western clawed frog LOC100125119 antibody; Xenopus tropicalis LOC100125119 antibody A4QN94 92%
White-tufted-ear marmoset CAD antibody; Callithrix jacchus CAD antibody F7I7B7 100%
Zebrafish cad antibody; Danio rerio cad antibody Q5XLV0 100%
Zebrafish cad antibody; Danio rerio cad antibody Q5RHG9 100%
Zebrafish cad antibody; Danio rerio cad antibody Q5RHG8 100%
Zebrafish cad antibody; Danio rerio cad antibody Q5EI67 100%
Zebrafish cad antibody; Danio rerio cad antibody F1QS90 100%
Zebrafish cad antibody; Danio rerio cad antibody F1QS89 100%
Zebrafish cad antibody; Danio rerio cad antibody F1Q9V4 100%

Product Protocols: CAD antibody tested with Human Fetal Lung Tissue (ARP46104_P050)

Aviva Systems Biology is the original manufacturer of this CAD antibody (ARP46104_P050)

Click here to view the CAD antibody Western Blot Protocol

Product Datasheet Link: CAD antibody (ARP46104_P050)

WB Suggested Anti-CAD Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Fetal Lung

Western Blot image:

Description of Target: CAD is a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides.The de novo synthesis of pyrimidine nucleotides is required for mammalian cells to proliferate. This gene encodes a trifunctional protein which is associated with the enzymatic activities of the first 3 enzymes in the 6-step pathway of pyrimidine biosynthesis: carbamoylphosphate synthetase (CPS II), aspartate transcarbamoylase, and dihydroorotase. This protein is regulated by the mitogen-activated protein kinase (MAPK) cascade, which indicates a direct link between activation of the MAPK cascade and de novo biosynthesis of pyrimidine nucleotides. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s CAD antibody (ARP46104_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question