SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP60097_P050
Price: $0.00
SKU
ARP60097_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-CA5A (ARP60097_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Horse
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CA5A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 85%; Dog: 77%; Horse: 85%; Human: 100%; Rat: 79%
Peptide SequenceSynthetic peptide located within the following region: AVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDY
Concentration0.5 mg/ml
Blocking PeptideFor anti-CA5A (ARP60097_P050) antibody is Catalog # AAP60097 (Previous Catalog # AAPP46242)
Gene SymbolCA5A
Gene Full NameCarbonic anhydrase VA, mitochondrial
Alias SymbolsCA5, CAV, CAVA, CA5AD, GS1-21A4.1
NCBI Gene Id763
Protein NameCarbonic anhydrase 5A, mitochondrial
Description of TargetCarbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2.
Uniprot IDP35218
Protein Accession #NP_001730
Nucleotide Accession #NM_001739
Protein Size (# AA)305
Molecular Weight34kDa
Protein InteractionsUBC;
  1. What is the species homology for "CA5A Antibody - C-terminal region (ARP60097_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Horse".

  2. How long will it take to receive "CA5A Antibody - C-terminal region (ARP60097_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "CA5A Antibody - C-terminal region (ARP60097_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "CA5A Antibody - C-terminal region (ARP60097_P050)"?

    This target may also be called "CA5, CAV, CAVA, CA5AD, GS1-21A4.1" in publications.

  5. What is the shipping cost for "CA5A Antibody - C-terminal region (ARP60097_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "CA5A Antibody - C-terminal region (ARP60097_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "CA5A Antibody - C-terminal region (ARP60097_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "CA5A Antibody - C-terminal region (ARP60097_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "CA5A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "CA5A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "CA5A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "CA5A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "CA5A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "CA5A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:CA5A Antibody - C-terminal region (ARP60097_P050)
Your Rating