SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP51212_T100
Price: $0.00
SKU
ARP51212_T100
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

C3orf10 Antibody - middle region (ARP51212_T100)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for ARP51212_T100
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Horse, Pig, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Lane A: Marker. Lane B: HepG2 cell lysate. Antibody concentration: 2.5 ug/ml. Gel concentration: 15%.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C3orf10
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
Concentration1.0 mg/ml
Blocking PeptideCatalog # AAP51212 (Previous Catalog # AAPP28080)
Gene SymbolBRK1
Gene Full NameBRICK1, SCAR/WAVE actin-nucleating complex subunit
Alias SymbolsMDS027, hHBrk1, C3orf10, HSPC300
NCBI Gene Id55845
Protein NameProtein BRICK1
Description of TargetC3orf10 is involved in regulation of actin and microtubule organization. It is a part of a WAVE complex that activates the Arp2/3 complex.
Uniprot IDQ8WUW1
Protein Accession #NP_060932
Nucleotide Accession #NM_018462
Protein Size (# AA)75
Molecular Weight9kDa
Protein InteractionsDTNBP1; ACTBL2; NCKAP1; CDKN2A; ACTG1; ACTA1; UBC; PFDN1; CYFIP2; WASF1; NCK1;
  1. What is the species homology for "C3orf10 Antibody - middle region (ARP51212_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Horse, Pig, Zebrafish".

  2. How long will it take to receive "C3orf10 Antibody - middle region (ARP51212_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C3orf10 Antibody - middle region (ARP51212_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C3orf10 Antibody - middle region (ARP51212_T100)"?

    This target may also be called "MDS027, hHBrk1, C3orf10, HSPC300" in publications.

  5. What is the shipping cost for "C3orf10 Antibody - middle region (ARP51212_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C3orf10 Antibody - middle region (ARP51212_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C3orf10 Antibody - middle region (ARP51212_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "9kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C3orf10 Antibody - middle region (ARP51212_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BRK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BRK1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BRK1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BRK1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BRK1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BRK1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C3orf10 Antibody - middle region (ARP51212_T100)
Your Rating