website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

US

C2 antibody - N-terminal region (ARP41668_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
    $289.00
    In Stock
    Click here to learn more about Aviva's By-Request Conjugation Service.
    Gene Symbol:
    CO2, DKFZp779M0311
    NCBI Gene Id:
    717
    Official Gene Full Name:
    Complement component 2
    Protein Name:
    Complement C2
    Swissprot Id:
    P06681
    Protein Accession #:
    NP_000054
    Nucleotide Accession #:
    NM_000063
    Alias Symbols:
    CO2, DKFZp779M0311
    Description of Target:
    Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
    Protein Size (# AA):
    752
    Molecular Weight:
    81kDa
    Host:
    Rabbit
    Clonality:
    Polyclonal
    Purification:
    Affinity Purified
    Application:
    WB
    Tissue Tool:
    Find tissues and cell lines supported by DNA array analysis to express C2.
    RNA Seq:
    Find tissues and cell lines supported by RNA-seq analysis to express C2.
    Immunogen:
    The immunogen is a synthetic peptide directed towards the N terminal region of human C2
    Species Reactivity:
    Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
    Predicted Homology Based on Immunogen Sequence:
    Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
    Complete computational species homology data:
    Anti-C2 (ARP41668_P050)
    Peptide Sequence:
    Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
    Product Format:
    Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
    Reconstitution and Storage:
    For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
    Concentration:
    Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
    Protein Interactions:
    PSMA4; MASP1; C5; C3; C4B;
    Blocking Peptide:
    For anti-C2 (ARP41668_P050) antibody is Catalog # AAP41668 (Previous Catalog # AAPP10801)
    Datasheets / Downloads:
    Printable datasheet for anti-C2 (ARP41668_P050) antibody
    Target Reference:
    Lee,K.Y., (2008) Invest. Ophthalmol. Vis. Sci. 49 (6), 2613-2619

    Product Protocols: C2 antibody tested with Human Fetal Heart Tissue (ARP41668_P050)

    Aviva Systems Biology is the original manufacturer of this C2 antibody (ARP41668_P050)

    Click here to view the C2 antibody Western Blot Protocol

    Product Datasheet Link: C2 antibody (ARP41668_P050)

    WB Suggested Anti-C2 Antibody Titration: 0.2-1 ug/ml
    Positive Control: Fetal Heart

    Western Blot image:


    Description of Target: Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

    Questions pertaining to this data can be directed to techsupport@avivasysbio.com

    Aviva Systems Biology’s C2 antibody (ARP41668_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

    To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

    All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

     
    X
    Ask a Question