website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

C2 antibody - N-terminal region (ARP41668_P050)

Description of Target:
Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Complement component 2
NCBI Gene Id:
Alias Symbols:
CO2; DKFZp779M0311
Tissue Tool:
Find tissues and cell lines supported to express C2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Complement C2
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
C3, C5, MASP1, PSMA4, C4B
The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
C2 antibody - N-terminal region (ARP41668_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%
Species Reactivity:
Human, Pig, Mouse, Horse, Rabbit, Bovine, Rat, Dog, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-C2 antibody
- ARP41668_P050
Peptide Sequence:
Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
Blocking Peptide:
For anti-C2 antibody is Catalog # AAP41668 (Previous Catalog # AAPP10801)
Target Reference:
Lee,K.Y., (2008) Invest. Ophthalmol. Vis. Sci. 49 (6), 2613-2619
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-C2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.

Computational species homology for C2 antibody (ARP41668)

Product page for C2 antibody (ARP41668)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
African elephant LOC100668309 antibody; Loxodonta africana LOC100668309 antibody G3TCU0 100%
Bornean orangutan CO2 antibody; Pongo pygmaeus CO2 antibody Q8SQ75 100%
Bovine Bt.48846 antibody; Bos taurus Bt.48846 antibody G1K1E3 100%
Bovine C2 antibody; Bos taurus C2 antibody Q0V7N2 100%
Bovine CO2 antibody; Bos taurus CO2 antibody Q3SYW2 100%
Chimpanzee CO2 antibody; Pan troglodytes CO2 antibody Q8SQ74 100%
Dog C2 antibody; Canis familiaris C2 antibody E2RS79 92%
Giant panda LOC100474163 antibody; Ailuropoda melanoleuca LOC100474163 antibody D2I357 100%
Gray short-tailed opossum LOC100025443 antibody; Monodelphis domestica LOC100025443 antibody F6VTJ5 85%
Guinea pig C2 antibody; Cavia porcellus C2 antibody H0W459 92%
Horse C2 antibody; Equus caballus C2 antibody F6PPQ0 100%
Human C2 antibody; Homo sapiens C2 antibody Q95IG1 100%
Human C2 antibody; Homo sapiens C2 antibody Q8N6L6 100%
Human C2 antibody; Homo sapiens C2 antibody Q5ST57 100%
Human C2 antibody; Homo sapiens C2 antibody Q5JP69 100%
Human C2 antibody; Homo sapiens C2 antibody Q53HP3 100%
Human C2 antibody; Homo sapiens C2 antibody H0Y4Z4 100%
Human C2 antibody; Homo sapiens C2 antibody H0Y4A5 100%
Human C2 antibody; Homo sapiens C2 antibody H0Y3H6 100%
Human C2 antibody; Homo sapiens C2 antibody F2Z3N2 100%
Human C2 antibody; Homo sapiens C2 antibody E9PFN7 100%
Human C2 antibody; Homo sapiens C2 antibody C9JYQ5 100%
Human C2 antibody; Homo sapiens C2 antibody B4DPF3 100%
Human C2 antibody; Homo sapiens C2 antibody A8MPR8 100%
Human C2 antibody; Homo sapiens C2 antibody A2BE06 100%
Human C2 antibody; Homo sapiens C2 antibody A2BE05 100%
Human C2 antibody; Homo sapiens C2 antibody A2ABK0 100%
Human C2 antibody; Homo sapiens C2 antibody A2ABG1 100%
Human C2 antibody; Homo sapiens C2 antibody A2ABG0 100%
Human C2 antibody; Homo sapiens C2 antibody Q53GZ8 92%
Human C2 antibody; Homo sapiens C2 antibody B4DV20 92%
Human CFB antibody; Homo sapiens CFB antibody E7EVA3 100%
Human CFB antibody; Homo sapiens CFB antibody B4E1Z4 100%
Human CO2 antibody; Homo sapiens CO2 antibody P06681 100%
Lowland gorilla CO2 antibody; Gorilla gorilla gorilla CO2 antibody Q863A0 100%
Lowland gorilla ENSG00000244255 antibody; Gorilla gorilla gorilla ENSG00000244255 antibody G3SJ06 100%
Lowland gorilla ENSG00000244255 antibody; Gorilla gorilla gorilla ENSG00000244255 antibody G3SGX9 100%
Lowland gorilla ENSG00000244255 antibody; Gorilla gorilla gorilla ENSG00000244255 antibody G3S5M5 100%
Lowland gorilla ENSG00000244255 antibody; Gorilla gorilla gorilla ENSG00000244255 antibody G3QIL0 100%
Mouse C2 antibody; Mus musculus C2 antibody B8JJN2 100%
Mouse C2 antibody; Mus musculus C2 antibody B8JJM9 100%
Mouse CO2 antibody; Mus musculus CO2 antibody P21180 100%
Mouse CO2 antibody; Mus musculus CO2 antibody P21180-2 100%
Mouse Gm20547 antibody; Mus musculus Gm20547 antibody B8JJN0 100%
Pig C2 antibody; Sus scrofa C2 antibody A5PF03 100%
Pig C2 antibody; Sus scrofa C2 antibody A5PF02 100%
Pig SBAB-707F1.3 antibody; Sus scrofa SBAB-707F1.3 antibody F1RQW8 100%
Pig SBAB-707F1.3 antibody; Sus scrofa SBAB-707F1.3 antibody F1RQW7 100%
Rat C2 antibody; Rattus norvegicus C2 antibody Q8CIP8 100%
Rat C2 antibody; Rattus norvegicus C2 antibody Q6MG73 100%
Rhesus macaque C2 antibody; Macaca mulatta C2 antibody F7D5J9 100%
Rhesus macaque C2 antibody; Macaca mulatta C2 antibody F7CNH9 100%
Rhesus macaque C2 antibody; Macaca mulatta C2 antibody F6YK65 100%
Sumatran orangutan DKFZP469A1324 antibody; Pongo abelii DKFZP469A1324 antibody Q5RE78 100%

Product Protocols: C2 antibody tested with Human Fetal Heart Tissue (ARP41668_P050)

Aviva Systems Biology is the original manufacturer of this C2 antibody (ARP41668_P050)

Click here to view the C2 antibody Western Blot Protocol

Product Datasheet Link: C2 antibody (ARP41668_P050)

WB Suggested Anti-C2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Heart

Western Blot image:

Description of Target: Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s C2 antibody (ARP41668_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question