website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
In Stock

C2 antibody - N-terminal region (ARP41668_P050)

Description of Target:
Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Gene Symbol:
Official Gene Full Name:
Complement component 2
NCBI Gene Id:
Alias Symbols:
CO2; DKFZp779M0311
Tissue Tool:
Find tissues and cell lines supported to express C2.
Protein Accession #:
Nucleotide Accession#:
Swissprot Id:
Protein Name:
Complement C2
Protein Size (# AA):
Molecular Weight:
Partner Proteins:
C3, C5, MASP1, PSMA4, C4B
The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2
Product Format:
Lyophilized powder
Affinity Purified
Complete computational species homology data:
C2 antibody - N-terminal region (ARP41668_P050)
Predicted Homology Based on Immunogen Sequence:
Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Dog: 93%; Guinea pig: 93%
Species Reactivity:
Human, Pig, Mouse, Horse, Rabbit, Bovine, Rat, Dog, Guinea pig
Datasheets / Downloads:
Printable datasheet for
anti-C2 antibody
- ARP41668_P050
Peptide Sequence:
Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
Blocking Peptide:
For anti-C2 antibody is Catalog # AAP41668 (Previous Catalog # AAPP10801)
Key Reference:
Lee,K.Y., (2008) Invest. Ophthalmol. Vis. Sci. 49 (6), 2613-2619
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-C2 antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Ask a Question