website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
100 ul
In Stock

C2 antibody - N-terminal region (ARP41668_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
CO2, DKFZp779M0311
NCBI Gene Id:
Official Gene Full Name:
Complement component 2
Protein Name:
Complement C2
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CO2, DKFZp779M0311
Description of Target:
Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express C2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express C2.
The immunogen is a synthetic peptide directed towards the N terminal region of human C2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-C2 (ARP41668_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
PSMA4; MASP1; C5; C3; C4B;
Blocking Peptide:
For anti-C2 (ARP41668_P050) antibody is Catalog # AAP41668 (Previous Catalog # AAPP10801)
Datasheets / Downloads:
Printable datasheet for anti-C2 (ARP41668_P050) antibody
Target Reference:
Lee,K.Y., (2008) Invest. Ophthalmol. Vis. Sci. 49 (6), 2613-2619

Product Protocols: C2 antibody tested with Human Fetal Heart Tissue (ARP41668_P050)

Aviva Systems Biology is the original manufacturer of this C2 antibody (ARP41668_P050)

Click here to view the C2 antibody Western Blot Protocol

Product Datasheet Link: C2 antibody (ARP41668_P050)

WB Suggested Anti-C2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Heart

Western Blot image:

Description of Target: Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases.Component C2 is part of the classical pathway of complement system. Activated C1 cleaves C2 into C2a and C2b. C2a leads to activation of C3. Deficiency of C2 has been reported to associated with certain autoimmune diseases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s C2 antibody (ARP41668_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Ask a Question