C1QB Antibody - C-terminal region (ARP44297_P050)

Catalog No: ARP44297_P050

WB Suggested Anti-C1QB Antibody Titration: 0.5ug/ml
Positive Control: Jurkat cell lysate

Human Muscle

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Dog, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Lane A: Marker. Lane B: Jurkat cell lysate. Antibody concentration: 0.5 ug/ml. Gel concentration: 12%.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C1QB
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Horse: 82%; Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-C1QB (ARP44297_P050) antibody is Catalog # AAP44297 (Previous Catalog # AAPP26657)
• Subunit: B
• Reference: Roumenina,L.T., (2006) Biochemistry 45 (13), 4093-4104
• Publications:

  Histopathological comparison of the onset of peri-implantitis and periodontitis in rats. Clin Oral Implants Res. 28, 163-170 (2017). 26804139

  Kuramoto, A. et al. The formation of immune complexes is involved in the acute phase of periodontal destruction in rats. J. Periodontal Res. 47, 455-62 (2012). 22283745

  Nagano, F. et al. Gram-positive bacteria as an antigen topically applied into gingival sulcus of immunized rat accelerates periodontal destruction. J. Periodontal Res. 48, 420-7 (2013). 23137272

  Nakatsu, S. et al. Occlusal trauma accelerates attachment loss at the onset of experimental periodontitis in rats. J. Periodontal Res. (2013). doi:10.1111/jre.12109 23808820

  The histopathological comparison on the destruction of the periodontal tissue between normal junctional epithelium and long junctional epithelium. J. Periodont. Res. 52, 74-82 (2017). 26957231

  Yoshinaga, Y. et al. Topical application of lipopolysaccharide into gingival sulcus promotes periodontal destruction in rats immunized with lipopolysaccharide. J. Periodontal Res. 47, 674-80 (2012). 22582894

Target Info

• Gene Symbol: C1QB
• Gene Full Name: Complement component 1, q subcomponent, B chain
• Alias Symbols: -
• NCBI Gene Id: 713
• Protein Name: Complement C1q subcomponent subunit B
• Description of Target: C1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q.
• Uniprot ID: P02746
• Protein Accession #: NP_000482
• Nucleotide Accession #: NM_000491
• Protein Size (# AA): 253
• Molecular Weight: 27kDa
• Protein Interactions: IL32; EED; FN1; EDA2R; RELA; MYOC; PTX3; C1R; HRG; DEFA1; C1QC; C1QA;