C1GALT1C1 Antibody - N-terminal region (ARP77316_P050)

Catalog No: ARP77316_P050

Host: Rabbit
Target Name: C1GALT1C1
Sample Tissue: Human Fetal Liver
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C1GALT1C1
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: GNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-C1GALT1C1 (ARP77316_P050) antibody is Catalog # AAP77316

Target Info

• Gene Symbol: C1GALT1C1
• Gene Full Name: C1GALT1-specific chaperone 1
• Alias Symbols: TNPS, COSMC, MST143, C1GALT2, HSPC067, C38H2-L1
• NCBI Gene Id: 29071
• Protein Name: C1GALT1-specific chaperone 1
• Description of Target: This gene encodes a type II transmembrane protein that is similar to the core 1 beta1,3-galactosyltransferase 1, which catalyzes the synthesis of the core-1 structure, also known as Thomsen-Friedenreich antigen, on O-linked glycans. This gene product lacks the galactosyltransferase activity itself, but instead acts as a molecular chaperone required for the folding, stability and full activity of the core 1 beta1,3-galactosyltransferase 1. Mutations in this gene have been associated with Tn syndrome. Alternatively spliced transcript variants encoding the same protein have been identified.
• Uniprot ID: Q96EU7
• Protein Accession #: NP_001011551.1
• Nucleotide Accession #: NM_001011551.2
• Protein Size (# AA): 375
• Molecular Weight: 36 kDa