Aviva Systems Biology will be closed in observance of Good Friday 3/29/2024. If you are in need of any assistance please email info@avivasysbio.com

Catalog No: ARP50771_P050
Price: $0.00
SKU
ARP50771_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-URI1 (ARP50771_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C19orf2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 100%; Rat: 80%
Peptide SequenceSynthetic peptide located within the following region: NGEYVPRKSILKSRSRENSVCSDTSESSAAEFDDRRGVLRSISCEEATCS
Concentration0.5 mg/ml
Blocking PeptideFor anti-URI1 (ARP50771_P050) antibody is Catalog # AAP50771 (Previous Catalog # AAPP29883)
Sample Type Confirmation

There is BioGPS gene expression data showing that URI1 is expressed in Hela, HepG2, MCF7

ReferenceDjouder,N., (2007) Mol. Cell 28 (1), 28-40
Gene SymbolURI1
Gene Full NameURI1, prefoldin-like chaperone
Alias SymbolsRMP, URI, NNX3, C19orf2, PPP1R19
NCBI Gene Id8725
Protein NameChromosome 19 open reading frame 2 EMBL AAH67259.1
Description of TargetThe function of the C19orf2 protein remains unknown.The protein encoded by this gene binds to RNA polymerase II subunit 5 (RPB5) and negatively modulates transcription through its binding to RPB5. The encoded protein seems to have inhibitory effects on various types of activated transcription, but it requires the RPB5-binding region. This protein acts as a corepressor. It is suggested that it may require signaling processes for its function or that it negatively modulates genes in the chromatin structure. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Uniprot IDQ6NX55
Protein Accession #NP_604431
Nucleotide Accession #NM_134447
Protein Size (# AA)495
Molecular Weight55kDa
Protein InteractionsRPAP3; UBC; ITCH; NEDD4; ATF7; TTI1; RUVBL1; RPS6KB1; PPP1CC; HSP90AA1; APP; UXT; RPAP2; GPN1; RUVBL2; STAP1; POLR2E; URI1; DMAP1; GTF2F2;
  1. What is the species homology for "C19orf2 Antibody - middle region (ARP50771_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "C19orf2 Antibody - middle region (ARP50771_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "C19orf2 Antibody - middle region (ARP50771_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "C19orf2 Antibody - middle region (ARP50771_P050)"?

    This target may also be called "RMP, URI, NNX3, C19orf2, PPP1R19" in publications.

  5. What is the shipping cost for "C19orf2 Antibody - middle region (ARP50771_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "C19orf2 Antibody - middle region (ARP50771_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "C19orf2 Antibody - middle region (ARP50771_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "55kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "C19orf2 Antibody - middle region (ARP50771_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "URI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "URI1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "URI1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "URI1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "URI1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "URI1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:C19orf2 Antibody - middle region (ARP50771_P050)
Your Rating