BTG2 Antibody - middle region (ARP33561_P050)

Catalog No: ARP33561_P050 (Formerly GWB-D54FE7)

WB Suggested Anti-BTG2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Lung

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BTG2
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 85%; Human: 100%; Mouse: 92%; Rabbit: 85%; Rat: 100%; Sheep: 92%
• Peptide Sequence: Synthetic peptide located within the following region: HKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BTG2 (ARP33561_P050) antibody is Catalog # AAP33561 (Previous Catalog # AAPP04616)
• Publications:

  BTG2 antagonizes Pin1 in response to mitogens and telomere disruption during replicative senescence. Aging Cell. 9, 747-60 (2010). 20569234

  Oncogenic human papillomaviruses block expression of the B-cell translocation gene-2 tumor suppressor gene. Int J Cancer. 125, 2014-20 (2009). 19551855

  Park, J.-I. et al. B-cell translocation gene 2: expression in the rat ovary and potential association with adenine nucleotide translocase 2 in mitochondria. Mol. Cell. Endocrinol. 367, 31-40 (2013). 23267836

• Description:
  View product citations for BTG2 Antibody - middle region (ARP33561_P050) on CiteAb

Target Info

• Gene Symbol: BTG2
• Gene Full Name: BTG family, member 2
• Alias Symbols: PC3, APRO1, TIS21
• NCBI Gene Id: 7832
• Protein Name: Protein BTG2
• Description of Target: BTG2 is an anti-proliferative protein. BTG2 modulates transcription regulation mediated by ESR1.
• Uniprot ID: P78543
• Protein Accession #: NP_006754
• Nucleotide Accession #: NM_006763
• Protein Size (# AA): 158
• Molecular Weight: 17kDa
• Protein Interactions: CNOT7; CNOT8; SRA1; FBXL3; FBXW2; FBXW11; BTRC; CUL1; UBC; SKP2; SKP1; HMGN1; PRMT1; PICK1; SMAD9; SMAD1; PRKCA; HOXC8; HOXB9; DYT10; CNOT1; CNOT6L;