BTBD14B Antibody - middle region (ARP34653_P050)

Catalog No: ARP34653_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

WB Suggested Anti-BTBD14B Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BTBD14B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: VVSGPSTSERTSPGTSSAYTSDSPGSYHNEEDEEEDGGEEGMDEQYRQIC
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NACC1 (ARP34653_P050) antibody is Catalog # AAP34653 (Previous Catalog # AAPP05843)
• Reference: Yeasmin,S., (2008) Clin. Cancer Res. 14 (6), 1686-1691

Target Info

• Gene Symbol: NACC1
• Gene Full Name: Nucleus accumbens associated 1, BEN and BTB (POZ) domain containing
• Alias Symbols: NAC1, BEND8, NAC-1, NECFM, BTBD30, BTBD14B
• NCBI Gene Id: 112939
• Protein Name: Nucleus accumbens-associated protein 1
• Description of Target: Members of the BTB/POZ family of transcriptional regulators, including BTBD14B, contain a conserved motif in the N-terminal region critical for protein-protein interactions and assembly of high molecular mass complexes.Members of the BTB/POZ family of transcriptional regulators, including BTBD14B, contain a conserved motif in the N-terminal region critical for protein-protein interactions and assembly of high molecular mass complexes (Korutla et al., 2002 [PubMed 11906783]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-42 BU508302.1 1-42 43-1846 AF395817.1 1-1804 1847-3973 AK094702.1 454-2580 3974-4556 BC055396.1 3917-4499
• Uniprot ID: Q96RE7
• Protein Accession #: NP_443108
• Nucleotide Accession #: NM_052876
• Protein Size (# AA): 527
• Molecular Weight: 57kDa
• Protein Interactions: SUMO2; UBC; PARK2; STRN3; KPNA4; KPNA3; TARDBP; NACC1; BCOR; KLHL2; ZBTB6; HDAC4; HDAC3; ENC1; ZBTB14; BCL6; CUL3; CUL4A; PSMD7;