SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP39076_P050
Price: $0.00
SKU
ARP39076_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-BRD4 (ARP39076_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationCHIP, IF, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human BRD4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: EIEIDFETLKPSTLRELERYVTSCLRKKRKPQAEKVDVIAGSSKMKGFSS
Concentration0.5 mg/ml
Blocking PeptideFor anti-BRD4 (ARP39076_P050) antibody is Catalog # AAP39076 (Previous Catalog # AAPS05411)
Enhanced Validation
WBY
SPR
YCHAROS
ReferenceSchweiger,M.R., (2006) J. Virol. 80 (9), 4276-4285
Gene SymbolBRD4
Gene Full NameBromodomain containing 4
Alias SymbolsCAP, MCAP, HUNK1, HUNKI
NCBI Gene Id23476
Protein NameBromodomain-containing protein 4
Description of TargetBRD4 is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting.The protein encoded by this gene is homologous to the murine protein MCAP, which associates with chromosomes during mitosis, and to the human RING3 protein, a serine/threonine kinase. Each of these proteins contains two bromodomains, a conserved sequence motif which may be involved in chromatin targeting. This gene has been implicated as the chromosome 19 target of translocation t(15;19)(q13;p13.1), which defines an upper respiratory tract carcinoma in young people. Two alternatively spliced transcript variants have been described.
Uniprot IDO60885-2
Protein Accession #NP_055114
Nucleotide Accession #NM_014299
Protein Size (# AA)1,362
Molecular Weight152 kDa
Protein InteractionsAFF1; CDK9; CCNT1; STAT3; JMJD6; TCERG1; HEXIM1; RN7SK; PRPF40A; vif; RPL6; MYC; MLLT1; ELAVL1; SUMO2; UBC; YWHAZ; KAT8; C8orf33; MESDC2; HIST1H4A; HIST1H3A; YWHAE; MED1; EP300; KDM5B; C7orf25; CHFR; CLDN1; RFC1; RFC4; HIST2H3C; HIST2H4A; MED12; MED24; ME
  1. What is the species homology for "BRD4 Antibody - C-terminal region (ARP39076_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit".

  2. How long will it take to receive "BRD4 Antibody - C-terminal region (ARP39076_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "BRD4 Antibody - C-terminal region (ARP39076_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "BRD4 Antibody - C-terminal region (ARP39076_P050)"?

    This target may also be called "CAP, MCAP, HUNK1, HUNKI" in publications.

  5. What is the shipping cost for "BRD4 Antibody - C-terminal region (ARP39076_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "BRD4 Antibody - C-terminal region (ARP39076_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "BRD4 Antibody - C-terminal region (ARP39076_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "152 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "BRD4 Antibody - C-terminal region (ARP39076_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "BRD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "BRD4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "BRD4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "BRD4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "BRD4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "BRD4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:BRD4 Antibody - C-terminal region (ARP39076_P050)
Your Rating
We found other products you might like!