BRCA1 Antibody - N-terminal region (ARP30434_P050)

Catalog No: ARP30434_P050

WB Suggested Anti-BRCA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: ACHN cell lysateBRCA1 is supported by BioGPS gene expression data to be expressed in ACHN

Rabbit Anti-BRCA1 Antibody
Catalog Number: ARP30434_P050
Formalin Fixed Paraffin Embedded Tissue: Human Lymph Node Tissue
Observed Staining: Cytoplasm
Primary Antibody Concentration: 1:100
Other Working Concentrations: N/A
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20X
Exposure Time: 0.5 - 2.0 sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Rat, Dog, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BRCA1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 92%; Horse: 85%; Human: 100%; Rabbit: 85%; Rat: 77%
• Peptide Sequence: Synthetic peptide located within the following region: MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLK
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BRCA1 (ARP30434_P050) antibody is Catalog # AAPP33639
• Sample Type Confirmation:

  BRCA1 is supported by BioGPS gene expression data to be expressed in ACHN

Target Info

• Gene Symbol: BRCA1
• Gene Full Name: Breast cancer 1, early onset
• Alias Symbols: IRIS, PSCP, BRCAI, BRCC1, FANCS, PNCA4, RNF53, BROVCA1, PPP1R53
• NCBI Gene Id: 672
• Protein Name: Breast cancer type 1 susceptibility protein
• Description of Target: The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. BRCA1 acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. BRCA1 plays a central role in DNA repair by facilitating cellular response to DNA repair. BRCA1 is required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. BRCA1 is involved in transcriptional regulation of P21 in response to DNA damage. BRCA1 is also required for FANCD2 targeting to sites of DNA damage.It may function as a transcriptional regulator. BRCA1 inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation.
• Uniprot ID: P38398
• Protein Accession #: NP_009229
• Nucleotide Accession #: NM_007298
• Protein Size (# AA): 680
• Molecular Weight: 76kDa
• Protein Interactions: RAD50; MED17; RAD51; YAP3; HDA3; SSN3; BEM4; GYP5; YAF9; HDAC2; MSH6; BAP1; SUPT5H; POLR2A; NPR1; NUP53; MET18; CDC21; MLP1; CTK1; MSH2; BACH1; DAN1; TMA22; BBC1; RPB4; SPT4; YGR053C; ATE1; YBP2; SLI15; RAD16; XRS2; RAD55; BUR2; BRIP1; ESR1; BECN1; HIST1H