- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-BRCA1 (ARP30434_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Rat, Dog, Horse, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BRCA1 |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Dog: 92%; Horse: 85%; Human: 100%; Rabbit: 85%; Rat: 77% |
Peptide Sequence | Synthetic peptide located within the following region: MDLSALRVEEVQNVINAMQKILECPICLELIKEPVSTKCDHIFCKFCMLK |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-BRCA1 (ARP30434_P050) antibody is Catalog # AAPP33639 |
Sample Type Confirmation | BRCA1 is supported by BioGPS gene expression data to be expressed in ACHN |
Gene Symbol | BRCA1 |
---|---|
Gene Full Name | Breast cancer 1, early onset |
Alias Symbols | IRIS, PSCP, BRCAI, BRCC1, FANCS, PNCA4, RNF53, BROVCA1, PPP1R53 |
NCBI Gene Id | 672 |
Protein Name | Breast cancer type 1 susceptibility protein |
Description of Target | The BRCA1-BARD1 heterodimer coordinates a diverse range of cellular pathways such as DNA damage repair, ubiquitination and transcriptional regulation to maintain genomic stability. BRCA1 acts by mediating ubiquitin E3 ligase activity that is required for its tumor suppressor function. BRCA1 plays a central role in DNA repair by facilitating cellular response to DNA repair. BRCA1 is required for appropriate cell cycle arrests after ionizing irradiation in both the S-phase and the G2 phase of the cell cycle. BRCA1 is involved in transcriptional regulation of P21 in response to DNA damage. BRCA1 is also required for FANCD2 targeting to sites of DNA damage.It may function as a transcriptional regulator. BRCA1 inhibits lipid synthesis by binding to inactive phosphorylated ACACA and preventing its dephosphorylation. |
Uniprot ID | P38398 |
Protein Accession # | NP_009229 |
Nucleotide Accession # | NM_007298 |
Protein Size (# AA) | 680 |
Molecular Weight | 76kDa |
Protein Interactions | RAD50; MED17; RAD51; YAP3; HDA3; SSN3; BEM4; GYP5; YAF9; HDAC2; MSH6; BAP1; SUPT5H; POLR2A; NPR1; NUP53; MET18; CDC21; MLP1; CTK1; MSH2; BACH1; DAN1; TMA22; BBC1; RPB4; SPT4; YGR053C; ATE1; YBP2; SLI15; RAD16; XRS2; RAD55; BUR2; BRIP1; ESR1; BECN1; HIST1H |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "BRCA1 Antibody - N-terminal region (ARP30434_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Dog, Horse, Rabbit".
-
How long will it take to receive "BRCA1 Antibody - N-terminal region (ARP30434_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "BRCA1 Antibody - N-terminal region (ARP30434_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "BRCA1 Antibody - N-terminal region (ARP30434_P050)"?
This target may also be called "IRIS, PSCP, BRCAI, BRCC1, FANCS, PNCA4, RNF53, BROVCA1, PPP1R53" in publications.
-
What is the shipping cost for "BRCA1 Antibody - N-terminal region (ARP30434_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "BRCA1 Antibody - N-terminal region (ARP30434_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "BRCA1 Antibody - N-terminal region (ARP30434_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "76kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "BRCA1 Antibody - N-terminal region (ARP30434_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "BRCA1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "BRCA1"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "BRCA1"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "BRCA1"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "BRCA1"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "BRCA1"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.