BMP4 Recombinant Protein (Human) (OPBG00077)

Catalog No: OPBG00077 (formerly GWB-BIG04B)

BMP4 Recombinant Protein (Human) (OPBG00077) using SDS-PAGE

Product Info

• Predicted Species Reactivity: Human
• Host: HeLa cells
• Additional Information: Verified by N-terminal and Mass Spectrometry analyses (when applicable).
  Endotoxin level is <0.1 ng/ug of protein (<1EU/ug).
  Biological Activity: Determined by its ability to induce alkaline phosphatase production by ATDC-5 cells.
• Reconstitution and Storage: Store at -20C. Avoid freeze/thaw cycles.
• Purity: 97% Verified by UV Spectroscopy and/or SDS-PAGE gel.
• Protein Sequence: Synthetic peptide located within the following region:
  HHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR

Target Info

• Gene Symbol: BMP4
• Gene Full Name: bone morphogenetic protein 4
• Alias Symbols: ZYME, BMP2B, OFC11, BMP2B1, MCOPS6
• NCBI Gene Id: 652
• Protein Name: bone morphogenetic protein 4
• Description of Target: Bone morphogenetic proteins (BMPs) constitute a subfamily within the TGF-beta superfamily of structurally related signaling proteins. Members of this superfamily are widely distributed throughout the body and are involved in diverse physiological processes during both pre- and postnatal life. Like BMP-7, BMP-4 is involved in the development and maintenance of bone and cartilage. Reduced expression of BMP-4 is associated with a number of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Recombinant human BMP-4, expressed in HeLa cells, is a 31-36 kDa homodimeric glycoprotein.
• Uniprot ID: P12644
• Protein Accession #: NP_001193.2
• Nucleotide Accession #: NM_001202.4