BLMH Antibody - middle region (ARP56106_P050)

Catalog No: ARP56106_P050

WB Suggested Anti-BLMH Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysateBLMH is supported by BioGPS gene expression data to be expressed in 721_B

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BLMH
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 93%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: EYLSNMVGGRKTLYNNQPIDFLKKMVAASIKDGEAVWFGCDVGKHFNSKL
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BLMH (ARP56106_P050) antibody is Catalog # AAP56106 (Previous Catalog # AAPP38011)
• Sample Type Confirmation:

  BLMH is supported by BioGPS gene expression data to be expressed in 721_B

• Reference: de (2008) J. Clin. Oncol. 26 (11), 1817-1823

Target Info

• Gene Symbol: BLMH
• Gene Full Name: Bleomycin hydrolase
• Alias Symbols: BH, BMH
• NCBI Gene Id: 642
• Protein Name: Bleomycin hydrolase
• Description of Target: The normal physiological role of BLM hydrolase is unknown, but it catalyzes the inactivation of the antitumor drug BLM (a glycopeptide) by hydrolyzing the carboxamide bond of its B-aminoalaninamide moiety thus protecting normal and malignant cells from BLM toxicity.Bleomycin hydrolase (BMH) is a cytoplasmic cysteine peptidase that is highly conserved through evolution; however, the only known activity of the enzyme is metabolic inactivation of the glycopeptide bleomycin (BLM), an essential component of combination chemotherapy regimens for cancer. The protein contains the signature active site residues of the cysteine protease papain superfamily. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: Q13867
• Protein Accession #: NP_000377
• Nucleotide Accession #: NM_000386
• Protein Size (# AA): 455
• Molecular Weight: 52kDa
• Protein Interactions: NUDT12; WDYHV1; BLMH; UBC; ZBTB1; SH3GLB2; LZTFL1; GORASP2; PES1; GTF2A1; AP1M2; CYP2C8; RNF32; ECSIT; MAST1; COPS5; CUL4B; SUMO2; PDPK1; Fam134a; USP53; KBTBD7; RPL11; UBE2I; TRIO; RPL29; APP;