website statistics
Account Login 

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

BDNF antibody - middle region (ARP41970_P050)

Scroll Horizontally to view all Images
Click here to learn more about Aviva's By-Request Conjugation Service.
Print Page
100 ul
In Stock
Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Brain-derived neurotrophic factor
Protein Name:
Brain-derived neurotrophic factor
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express BDNF.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express BDNF.
The immunogen is a synthetic peptide directed towards the middle region of human BDNF
Species Reactivity:
Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-BDNF (ARP41970_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-BDNF (ARP41970_P050) antibody is Catalog # AAP41970 (Previous Catalog # AAPS11111)
Datasheets / Downloads:
Printable datasheet for anti-BDNF (ARP41970_P050) antibody
Target Reference:
Hashimoto,R., (2008) Neurosci. Res. 61 (4), 360-367

McCarthy, D. M. et al. Cocaine alters BDNF expression and neuronal migration in the embryonic mouse forebrain. J. Neurosci. 31, 13400-11 (2011). WB, Rat, Pig, Mouse, Dog, Horse, Rabbit, Human 21940433

Horibe, I. et al. Induction of melanogenesis by 4’-O-methylated flavonoids in B16F10 melanoma cells. J. Nat. Med. 67, 705-10 (2013). WB, Rat, Pig, Mouse, Dog, Horse, Rabbit, Human 23242310

Product Protocols: BDNF antibody tested with Human Fetal Liver Tissue (ARP41970_P050)

Aviva Systems Biology is the original manufacturer of this BDNF antibody (ARP41970_P050)

Click here to view the BDNF antibody Western Blot Protocol

Product Datasheet Link: BDNF antibody (ARP41970_P050)

WB Suggested Anti-BDNF Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Liver

Western Blot image:

Description of Target: BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.

Questions pertaining to this data can be directed to

Aviva Systems Biology’s BDNF antibody (ARP41970_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at

Product Review: BDNF antibody-middle region (ARP41970_P050) in ventral horn region of mouse spinal cord using IHC

Product Page for BDNF antibody-middle region (ARP41970_P050)

Researcher: Timur Mavlyutov, University of Wisconsin Medical School
Application: IHC
Species+tissue/cell type:Ventral horn region of mouse spinal cord
Primary antibody dilution: 1:200
Secondary antibody: Donkey anti-rabbit CY2
Secondary antibody dilution:1:500

1: What species+tissue/cell type
Mouse spinal cord, ventral horn
2. Fixation method
Perfusion by 4% PFA and postfixation in same fixative
3. Antigen retrieval method used
No antigen retrieval, but permeabilization with 0.1%TritonX100
4. Primary antibody dilution
5. Secondary antibody
Donkey-anti-Rabbit CY2 conjugated (from Jackson labs)
6. Secondary antibody dilution
7. Description of Strains and counterstain
No counterstrains

Product Review:BDNF antibody-middle region (ARP41970_P050) in Rhesus macaque spinal cord using IHC

Product Page for BDNF antibody-middle region (ARP41970_P050)

Researcher:Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School
Application: IHC
Species+tissue/cell type:Rhesus macaque spinal cord
Primary antibody dilution: 1:300
Secondary antibody: Donkey anti Rabbit 488
Secondary antibody dilution: 1:500

1.Fixation method
-Perfusion by 4%PFA
2.Antigen retrieval method used
- permeabilization by 0.1% Triton X100
3.Primary antibody dilution
- All 1/300
4.Secondary antibody
-Donkey anti Rabbit 488
5.Secondary antibody dilution

Ask a Question