website statistics

Aviva Systems Biology

Account Login 

Aviva's office will be closed on 4/18/2014 for Good Friday holiday. Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

BDNF antibody - middle region (ARP41970_P050)

Receive a free blocking peptide (AAP41970) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Publications:

Anti-BDNF ARP41970_P050 has recently been referenced in the following publications:

McCarthy, D. M. et al. Cocaine alters BDNF expression and neuronal migration in the embryonic mouse forebrain. J. Neurosci. 31, 13400–11 (2011). WB, Mouse 21940433

Horibe, I. et al. Induction of melanogenesis by 4’-O-methylated flavonoids in B16F10 melanoma cells. J. Nat. Med. 67, 705–10 (2013). WB, Rat 23242310

Description of Target:
BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.
Gene Symbol:
BDNF
Official Gene Full Name:
Brain-derived neurotrophic factor
NCBI Gene Id:
627
Alias Symbols:
MGC34632
Tissue Tool:
Find tissues and cell lines supported to express BDNF.
Protein Accession #:
NP_001700
Nucleotide Accession#:
NM_001709
Swissprot Id:
P23560
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Brain-derived neurotrophic factor
Protein Size (# AA):
247
Molecular Weight:
27kDa
Application:
IHC, WB
Partner Proteins:
CCND3, CRABP2, CCND3
Immunogen:
The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
BDNF antibody - middle region (ARP41970_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Species Reactivity:
Rat, Pig, Mouse, Dog, Horse, Rabbit, Human
Datasheets / Downloads:
Printable datasheet for
anti-BDNF antibody
- ARP41970_P050
Peptide Sequence:
Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Blocking Peptide:
For anti-BDNF antibody is Catalog # AAP41970 (Previous Catalog # AAPS11111)
Key Reference:
Hashimoto,R., (2008) Neurosci. Res. 61 (4), 360-367
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-BDNF antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
 
X
Ask a Question