website statistics
Account Login 

Aviva Systems Biology office will be closed for Thanksgiving - Thursday 11/27/2014 and Friday 11/28/2014.
Please go here for more info.

Now Offering Over 85,203 Antibodies & 34,301 Antigens!

Print Page
50ug
$289.00
In Stock

BDNF antibody - middle region (ARP41970_P050)

Receive a free blocking peptide (AAP41970) when you purchase this antibody. Use the promotion code 'freepeptide' when placing your order.
Please go here for more details.
Description of Target:
BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.
Gene Symbol:
BDNF
Official Gene Full Name:
Brain-derived neurotrophic factor
NCBI Gene Id:
627
Alias Symbols:
MGC34632
Tissue Tool:
Find tissues and cell lines supported to express BDNF.
Protein Accession #:
NP_001700
Nucleotide Accession#:
NM_001709
Swissprot Id:
P23560
Host:
Rabbit
Clonality:
Polyclonal
Protein Name:
Brain-derived neurotrophic factor
Protein Size (# AA):
247
Molecular Weight:
27kDa
Application:
IHC, WB
Partner Proteins:
CCND3, CRABP2, CCND3
Immunogen:
The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF
Product Format:
Lyophilized powder
Purification:
Affinity Purified
Complete computational species homology data:
BDNF antibody - middle region (ARP41970_P050)
Predicted Homology Based on Immunogen Sequence:
Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%
Species Reactivity:
Rat, Pig, Mouse, Dog, Horse, Rabbit, Human
Datasheets / Downloads:
Printable datasheet for
anti-BDNF antibody
- ARP41970_P050
Peptide Sequence:
Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
Blocking Peptide:
For anti-BDNF antibody is Catalog # AAP41970 (Previous Catalog # AAPS11111)
Target Reference:
Hashimoto,R., (2008) Neurosci. Res. 61 (4), 360-367
Reconstitution and Storage:
Add 50 ul of distilled water. Final anti-BDNF antibody concentration is 1 mg/ml in PBS buffer with 2% sucrose. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Publications:

Anti-BDNF ARP41970_P050 has recently been referenced in the following publications:

McCarthy, D. M. et al. Cocaine alters BDNF expression and neuronal migration in the embryonic mouse forebrain. J. Neurosci. 31, 13400–11 (2011). WB, Mouse 21940433

Horibe, I. et al. Induction of melanogenesis by 4’-O-methylated flavonoids in B16F10 melanoma cells. J. Nat. Med. 67, 705–10 (2013). WB, Rat 23242310

Computational species homology for BDNF antibody (ARP41970)

Product page for BDNF antibody (ARP41970)

The information below lists the predicted species and target name associated to the peptide antigen. Please note, all available target reference numbers to the antigen sequence are presented, including unreviewed and protein isoforms.
To search for antibodies by species, please visit Aviva’s Species Reactivity Page. To search Aviva’s catalog of antibodies by sequence, please visit Aviva’s Antibody Blast Tool.

Predicted Species & Target Target Reference Predicted Homology
Aardvark BDNF antibody; Orycteropus afer BDNF antibody Q9BFJ9 100%
African clawed frog BDNF antibody; Xenopus laevis BDNF antibody P25432 100%
African clawed frog bdnf-b antibody; Xenopus laevis bdnf-b antibody Q63ZM5 100%
African clawed frog bndf antibody; Xenopus laevis bndf antibody F4ZGF6 100%
African elephant BDNF antibody; Loxodonta africana BDNF antibody Q9BFK2 100%
African pygmy dormouse BDNF antibody; Graphiurus murinus BDNF antibody G3M707 100%
African wild dog BDNF antibody; Lycaon pictus BDNF antibody Q2VDJ1 100%
American black bear BDNF antibody; Ursus americanus BDNF antibody Q2VDH2 100%
Aneides aeneus BDNF antibody A9QWK3 100%
Aneides ferreus BDNF antibody A9QWK4 100%
Aneides lugubris BDNF antibody A9QWK6 100%
Arctic fox BDNF antibody; Vulpes lagopus BDNF antibody Q2VDK2 100%
Argentine gray fox BDNF antibody; Pseudalopex griseus BDNF antibody Q2VDI6 100%
Asiatic black bear BDNF antibody; Ursus thibetanus BDNF antibody Q3SAT7 100%
Asiatic tapir BDNF antibody; Tapirus indicus BDNF antibody Q9BFH6 100%
Atlantic bottle-nosed dolphin BDNF antibody; Tursiops truncatus BDNF antibody Q9BFI4 100%
Australian ghost bat BDNF antibody; Macroderma gigas BDNF antibody Q5G6G8 100%
Bat-eared fox BDNF antibody; Otocyon megalotis BDNF antibody Q2VDI9 100%
Beaver BDNF antibody; Castor canadensis BDNF antibody Q99NW1 100%
Beecroft scaly-tailed squirrel BDNF antibody; Anomalurus beecrofti BDNF antibody G3M701 100%
Black bonneted bat BDNF antibody; Eumops auripendulus BDNF antibody Q5G6F0 100%
Black crested gibbon BDNF antibody; Nomascus concolor BDNF antibody Q9BFJ1 100%
black salamander BDNF antibody; Aneides flavipunctatus BDNF antibody A9QWK7 100%
black-backed jackal BDNF antibody; Canis mesomelas BDNF antibody Q2VDJ6 100%
Black-bellied hamster BDNF antibody; Cricetus cricetus BDNF antibody G3M704 100%
Black-winged little yellow bat BDNF antibody; Rhogeessa tumida BDNF antibody Q5G6F8 100%
Blainville beaked whale BDNF antibody; Mesoplodon densirostris BDNF antibody Q1XAG7 100%
Blandford fox BDNF antibody; Vulpes cana BDNF antibody Q2VDH9 100%
Bolitoglossa sp. MVZ:Herp:225875 BDNF antibody A9QWL0 100%
Bolivian tuco-tuco BDNF antibody; Ctenomys boliviensis BDNF antibody G3M706 100%
Bongo BDNF antibody; Tragelaphus eurycerus BDNF antibody Q9BFI1 100%
Bovine BDNF antibody; Bos taurus BDNF antibody Q95106 100%
Brazilian maned wolf BDNF antibody; Chrysocyon brachyurus BDNF antibody Q2VDJ3 100%
Brown bear BDNF antibody; Ursus arctos BDNF antibody O18752 100%
Brown bear BDNF antibody; Ursus arctos BDNF antibody Q9BFH1 100%
Brown kiwi BDNF antibody; Apteryx australis BDNF antibody B4Z8K6 100%
Brown-headed spider monkey BDNF antibody; Ateles fusciceps BDNF antibody Q9BFJ3 100%
California slender salamander BDNF antibody; Batrachoseps attenuatus BDNF antibody F6LWE2 100%
Cape fox BDNF antibody; Vulpes chama BDNF antibody Q2VDH8 100%
Cape hyrax BDNF antibody; Procavia capensis BDNF antibody Q9BFK3 100%
Capybara BDNF antibody; Hydrochoerus hydrochaeris BDNF antibody Q99NV0 100%
Carvalho Surinam toad bndf antibody; Pipa carvalhoi bndf antibody F4ZGG1 100%
Cat BDNF antibody; Felis catus BDNF antibody Q9TST3 100%
Cat BDNF antibody; Felis catus BDNF antibody Q9BFH5 100%
Celestus enneagrammus BDNF antibody E3T9X9 100%
Chimpanzee BDNF antibody; Pan troglodytes BDNF antibody Q5IS78 100%
Chinese hamster BDNF antibody; Cricetulus griseus BDNF antibody Q99NV6 100%
Chinese hamster LOC100768664 antibody; Cricetulus griseus LOC100768664 antibody G3ID16 100%
Chinese pangolin BDNF antibody; Manis pentadactyla BDNF antibody Q9BFH0 100%
Commerson leaf-nosed bat BDNF antibody; Hipposideros commersoni BDNF antibody Q5G6G9 100%
Common tube-nosed fruit bat BDNF antibody; Nyctimene albiventer BDNF antibody Q5G6H1 100%
Congo dwarf clawed frog bndf antibody; Hymenochirus boettgeri bndf antibody F4ZGF8 100%
Corsac fox BDNF antibody; Vulpes corsac BDNF antibody Q2VDH7 100%
Cottontail rabbit BDNF antibody; Sylvilagus floridanus BDNF antibody Q9BFJ8 100%
Coyote BDNF antibody; Canis latrans BDNF antibody Q2VDJ8 100%
Coypu BDNF antibody; Myocastor coypus BDNF antibody G3M703 100%
Crab-eating fox BDNF antibody; Cerdocyon thous BDNF antibody Q2VDJ4 100%
Creagh horseshoe bat BDNF antibody; Rhinolophus creaghi BDNF antibody Q5G6H0 100%
Culpeo fox BDNF antibody; Pseudalopex culpaeus BDNF antibody Q2VDI8 100%
Damaraland mole rat BDNF antibody; Cryptomys damarensis BDNF antibody E2J834 100%
Darwin zorro BDNF antibody; Lycalopex fulvipes BDNF antibody Q2VDI7 100%
dassie-rat BDNF antibody; Petromus typicus BDNF antibody G3M708 100%
Daubenton bat BDNF antibody; Myotis daubentonii BDNF antibody Q5G6F7 100%
Del Norte salamander BDNF antibody; Plethodon elongatus BDNF antibody A9QWJ5 100%
Desmognathus brimleyorum BDNF antibody A9QWH8 100%
Dhole BDNF antibody; Cuon alpinus BDNF antibody Q2VDJ2 100%
Dog BDNF antibody; Canis familiaris BDNF antibody Q7YRB4 100%
dusky salamander BDNF antibody; Desmognathus fuscus BDNF antibody A9QWH1 100%
East African long-eared elephant shrew BDNF antibody; Elephantulus rufescens BDNF antibody Q9BFK0 100%
Eastern chipmunk BDNF antibody; Tamias striatus BDNF antibody Q99NW2 100%
Egyptian slit-faced bat BDNF antibody; Nycteris thebaica BDNF antibody Q9BFI6 100%
Ensatina eschscholtzii BDNF antibody A9QWH5 100%
Ethiopian wolf BDNF antibody; Canis simensis BDNF antibody Q2VDJ5 100%
Eurasian common shrew BDNF antibody; Sorex araneus BDNF antibody Q9BFK4 100%
European suslik BDNF antibody; Spermophilus citellus BDNF antibody Q4L0Y3 100%
Fennec fox BDNF antibody; Vulpes zerda BDNF antibody Q2VDH3 100%
Fourche Mountain salamander BDNF antibody; Plethodon fourchensis BDNF antibody A9QWJ7 100%
four-toed salamander BDNF antibody; Hemidactylium scutatum BDNF antibody A9QWL1 100%
garden slender salamander BDNF antibody; Batrachoseps major BDNF antibody A9QWL4 100%
Geoffroy tailless bat BDNF antibody; Anoura geoffroy BDNF antibody Q5G6G1 100%
Giant anteater BDNF antibody; Myrmecophaga tridactyla BDNF antibody Q9BFK8 100%
Giant panda BDNF antibody; Ailuropoda melanoleuca BDNF antibody Q6LCI5 100%
Giant panda BDNF antibody; Ailuropoda melanoleuca BDNF antibody Q2VDH1 100%
Goeldi marmoset BDNF antibody; Callimico goeldii BDNF antibody Q9BFJ0 100%
Golden hamster Bdnf antibody; Mesocricetus auratus Bdnf antibody C0KY80 100%
Golden jackal BDNF antibody; Canis aureus BDNF antibody Q2VDJ9 100%
Gray fox BDNF antibody; Speothos venaticus BDNF antibody Q2VDI2 100%
Gray fox BDNF antibody; Urocyon cinereoargenteus BDNF antibody Q2VDI1 100%
Gray wolf BDNF antibody; Canis lupus BDNF antibody Q2VDJ7 100%
Guinea pig BDNF antibody; Cavia porcellus BDNF antibody O70183 100%
Hazel mouse BDNF antibody; Muscardinus avellanarius BDNF antibody Q99NW0 100%
Heermann kangaroo rat BDNF antibody; Dipodomys heermanni BDNF antibody Q99NV3 100%
Hippopotamus BDNF antibody; Hippopotamus amphibius BDNF antibody Q9BFI3 100%
Hoary fox BDNF antibody; Pseudalopex vetulus BDNF antibody Q2VDI3 100%
Hoffmann two-fingered sloth BDNF antibody; Choloepus hoffmanni BDNF antibody Q9BFL3 100%
Horse BDNF antibody; Equus caballus BDNF antibody Q0EAB7 100%
Horse BDNF antibody; Equus caballus BDNF antibody Q9BFH8 100%
Human BDNF antibody; Homo sapiens BDNF antibody P23560 100%
Human BDNF antibody; Homo sapiens BDNF antibody P23560-5 100%
Human BDNF antibody; Homo sapiens BDNF antibody P23560-4 100%
Human BDNF antibody; Homo sapiens BDNF antibody P23560-3 100%
Human BDNF antibody; Homo sapiens BDNF antibody P23560-2 100%
Humpback whale BDNF antibody; Megaptera novaeangliae BDNF antibody Q9BFI5 100%
Hydromantes ambrosii ambrosii BDNF antibody B9VTB6 100%
Hydromantes ambrosii bianchii BDNF antibody B9VTB4 100%
Hydromantes imperialis BDNF antibody B9VTE6 100%
Hydromantes imperialis BDNF antibody B9VTD8 100%
Hydromantes sarrabusensis BDNF antibody B9VTF3 100%
Hydromantes sarrabusensis BDNF antibody B9VTF2 100%
Indian flying fox BDNF antibody; Pteropus giganteus BDNF antibody Q9BFI8 100%
Indo-pacific bottle-nosed dolphin BDNF antibody; Tursiops aduncus BDNF antibody Q1XAG6 100%
Indo-pacific humpbacked dolphin BDNF antibody; Sousa chinensis BDNF antibody Q1XAG5 100%
Island grey fox BDNF antibody; Urocyon littoralis BDNF antibody Q2VDI0 100%
Italian cave salamander BDNF antibody; Hydromantes italicus BDNF antibody B9VTG2 100%
Italian cave salamander BDNF antibody; Hydromantes italicus BDNF antibody B9VTG1 100%
Italian cave salamander BDNF antibody; Hydromantes italicus BDNF antibody B9VTG0 100%
Italian cave salamander BDNF antibody; Hydromantes italicus BDNF antibody B9VTF7 100%
Italian cave salamander BDNF antibody; Hydromantes italicus BDNF antibody A9QWI5 100%
Jaguar BDNF antibody; Panthera onca BDNF antibody Q9BFH3 100%
Jamaican fruit-eating bat BDNF antibody; Artibeus jamaicensis BDNF antibody Q9BFI9 100%
Japanese macaque BDNF antibody; Macaca fuscata BDNF antibody Q9TT22 100%
Jordan salamander BDNF antibody; Plethodon jordani BDNF antibody A9QWJ4 100%
Karsenia koreana BDNF antibody A9QWI1 100%
Kit fox BDNF antibody; Vulpes macrotis BDNF antibody Q2VDH6 100%
Kitti hog-nosed bat BDNF antibody; Craseonycteris thonglongyai BDNF antibody Q5G6E9 100%
Laotian rock rat BDNF antibody; Laonastes aenigmamus BDNF antibody G3M709 100%
Larch Mountain salamander BDNF antibody; Plethodon larselli BDNF antibody A9QWJ8 100%
Lesser bulldog bat BDNF antibody; Noctilio albiventris BDNF antibody Q5G6G0 100%
Lesser mouse-tailed bat BDNF antibody; Rhinopoma hardwickei BDNF antibody Q5G6G7 100%
Lesser panda BDNF antibody; Ailurus fulgens BDNF antibody O97759 100%
Lesser short-nosed fruit bat BDNF antibody; Cynopterus brachyotis BDNF antibody Q5G6H2 100%
Lesser tree shrew BDNF antibody; Tupaia minor BDNF antibody Q9BFJ5 100%
limestone salamander BDNF antibody; Hydromantes brunus BDNF antibody A9QWI4 100%
Llama BDNF antibody; Lama glama BDNF antibody Q9BFI2 100%
Long-haired rousette BDNF antibody; Rousettus lanosus BDNF antibody Q9BFI7 100%
Malayan flying lemur BDNF antibody; Galeopterus variegatus BDNF antibody Q9BFJ6 100%
Malayan porcupine BDNF antibody; Hystrix brachyura BDNF antibody Q99NV5 100%
Malayan sun bear BDNF antibody; Ursus malayanus BDNF antibody O18753 100%
many-lined salamander BDNF antibody; Stereochilus marginatus BDNF antibody A9QWH2 100%
Merlin clawed frog bndf antibody; Pseudhymenochirus merlini bndf antibody F4ZGG0 100%
Mexican funnel-eared bat BDNF antibody; Natalus stramineus BDNF antibody Q5G6F1 100%
Middle East blind mole rat BDNF antibody; Spalax ehrenbergi BDNF antibody G3M710 100%
Montane guinea pig BDNF antibody; Cavia tschudii BDNF antibody Q99NV1 100%
Monte Albo cave salamander BDNF antibody; Hydromantes flavus BDNF antibody B9VTC3 100%
Monte Albo cave salamander BDNF antibody; Hydromantes flavus BDNF antibody B9VTB9 100%
Monte Albo cave salamander BDNF antibody; Hydromantes flavus BDNF antibody B9VTB8 100%
Mount Lyell salamander BDNF antibody; Hydromantes platycephalus BDNF antibody A9QWI7 100%
Mountain beaver BDNF antibody; Aplodontia rufa BDNF antibody G3M702 100%
Mountain paca BDNF antibody; Agouti taczanowskii BDNF antibody Q99NU8 100%
Mouse BDNF antibody; Mus musculus BDNF antibody P21237 100%
Mouse Bdnf antibody; Mus musculus Bdnf antibody Q99NV8 100%
Mouse Bdnf antibody; Mus musculus Bdnf antibody Q8VHH4 100%
Mouse Bdnf antibody; Mus musculus Bdnf antibody Q8CCH9 100%
Mouse Bdnf antibody; Mus musculus Bdnf antibody Q541P3 100%
Mouse Bdnf antibody; Mus musculus Bdnf antibody A2AII2 100%
Naked mole rat BDNF antibody; Heterocephalus glaber BDNF antibody E2J836 100%
Naked-rumped tomb bat BDNF antibody; Taphozous nudiventris BDNF antibody Q5G6G5 100%
New Zealand lesser short-tailed bat BDNF antibody; Mystacina tuberculata BDNF antibody Q5G6F3 100%
North American porcupine BDNF antibody; Erethizon dorsatum BDNF antibody Q99NV4 100%
Northern elephant seal BDNF antibody; Mirounga angustirostris BDNF antibody Q2VDH0 100%
Northern gundi BDNF antibody; Ctenodactylus gundi BDNF antibody G3M705 100%
Northern pika BDNF antibody; Ochotona hyperborea BDNF antibody Q9BFJ7 100%
Nototriton abscondens BDNF antibody F6LWE1 100%
Ocelot BDNF antibody; Leopardus pardalis BDNF antibody Q9BFH4 100%
Okapi BDNF antibody; Okapia johnstoni BDNF antibody Q9BFH9 100%
Old world sucker-footed bat BDNF antibody; Myzopoda aurita BDNF antibody Q5G6F6 100%
Oregon slender salamander BDNF antibody; Batrachoseps wrighti BDNF antibody F6LWD9 100%
Oriental fire-bellied toad BDNF antibody; Bombina orientalis BDNF antibody A4L7M3 100%
pacarana BDNF antibody; Dinomys branickii BDNF antibody Q99NU9 100%
Pallid bat BDNF antibody; Antrozous pallidus BDNF antibody Q5G6F9 100%
Pampas fox BDNF antibody; Pseudalopex gymnocercus BDNF antibody Q2VDI5 100%
Parnell mustached bat BDNF antibody; Pteronotus parnellii BDNF antibody Q5G6F5 100%
Peters sheath-tailed bat BDNF antibody; Emballonura atrata BDNF antibody Q5G6G6 100%
Petromyscus sp. WM-2011 BDNF antibody G3M711 100%
Pig BDNF antibody; Sus scrofa BDNF antibody P14082 100%
Pig BDNF antibody; Sus scrofa BDNF antibody Q9BFI0 100%
Pigmy Bryde whale BDNF antibody; Balaenoptera edeni BDNF antibody Q1XAG8 100%
Prairie vole BDNF antibody; Microtus ochrogaster BDNF antibody E0V837 100%
Proboscis bat BDNF antibody; Rhynchonycteris naso BDNF antibody Q5G6G4 100%
Raccoon BDNF antibody; Procyon lotor BDNF antibody O18755 100%
Raccoon dog BDNF antibody; Nyctereutes procyonoides BDNF antibody Q2VDJ0 100%
Rat BDNF antibody; Rattus norvegicus BDNF antibody P23363 100%
Rat Bdnf antibody; Rattus norvegicus Bdnf antibody Q99NV7 100%
Rat Bdnf antibody; Rattus norvegicus Bdnf antibody C8CEB1 100%
Red fox BDNF antibody; Vulpes vulpes BDNF antibody Q2VDH4 100%
Red Hills salamander BDNF antibody; Phaeognathus hubrichti BDNF antibody A9QWH3 100%
red salamander BDNF antibody; Pseudotriton ruber BDNF antibody A9QWL3 100%
red-backed salamander BDNF antibody; Plethodon cinereus BDNF antibody F6LWD8 100%
Rhesus macaque BDNF antibody; Macaca mulatta BDNF antibody Q06225 100%
Rhesus macaque BDNF antibody; Macaca mulatta BDNF antibody Q9BFJ2 100%
Rich Mountain salamander BDNF antibody; Plethodon ouachitae BDNF antibody A9QWJ0 100%
Ring-tailed lemur BDNF antibody; Lemur catta BDNF antibody Q9BFJ4 100%
Risso dolphin BDNF antibody; Grampus griseus BDNF antibody Q1XAG3 100%
Rueppel fox BDNF antibody; Vulpes rueppellii BDNF antibody Q2VDH5 100%
Sacramento mountain salamander BDNF antibody; Aneides hardii BDNF antibody A9QWH0 100%
Sardinian cave salamander BDNF antibody; Hydromantes genei BDNF antibody B9VTD7 100%

Product Protocols: BDNF antibody tested with Human Fetal Liver Tissue (ARP41970_P050)

Aviva Systems Biology is the original manufacturer of this BDNF antibody (ARP41970_P050)

Click here to view the BDNF antibody Western Blot Protocol

Product Datasheet Link: BDNF antibody (ARP41970_P050)

WB Suggested Anti-BDNF Antibody Titration: 0.2-1 ug/ml
Positive Control: Fetal Liver

Western Blot image:


Description of Target: BDNF is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression BDNF is reduced in both Alzheimer's and Huntington disease patients. BDNF may play a role in the regulation of stress response and in the biology of mood disorders.The protein encoded by this gene is a member of the nerve growth factor family. It is induced by cortical neurons, and is necessary for survival of striatal neurons in the brain. Expression of this gene is reduced in both Alzheimer's and Huntington disease patients. This gene may play a role in the regulation of stress response and in the biology of mood disorders. Multiple transcript variants encoding distinct isoforms have been described for this gene, but the full-length nature of only some could be determined.

Questions pertaining to this data can be directed to techsupport@avivasysbio.com

Aviva Systems Biology’s BDNF antibody (ARP41970_P050) has been tested using other cell lysates and tissues. To obtain more data about this antibody please email us at info@avivasysbio.com.

To order by phone call us at (888) 880-0001, fax us at (858) 552-6975 or send an email to info@avivasysbio.com. Aviva manufactures this antibody so we can offer the best price. Please contact us to request pricing information.

All of Aviva’s products are guaranteed for the applications and experimental sample types mentioned in the datasheet below. Are you curious if this product will work for you? Please contact us at techsupport@avivasysbio.com

Product Review: BDNF antibody-middle region (ARP41970_P050) in ventral horn region of mouse spinal cord using IHC

Product Page for BDNF antibody-middle region (ARP41970_P050)

Researcher: Timur Mavlyutov, University of Wisconsin Medical School
Application: IHC
Species+tissue/cell type:Ventral horn region of mouse spinal cord
Primary antibody dilution: 1:200
Secondary antibody: Donkey anti-rabbit CY2
Secondary antibody dilution:1:500

Questionnaire
1: What species+tissue/cell type
Mouse spinal cord, ventral horn
2. Fixation method
Perfusion by 4% PFA and postfixation in same fixative
3. Antigen retrieval method used
No antigen retrieval, but permeabilization with 0.1%TritonX100
4. Primary antibody dilution
1/200
5. Secondary antibody
Donkey-anti-Rabbit CY2 conjugated (from Jackson labs)
6. Secondary antibody dilution
1/500
7. Description of Strains and counterstain
No counterstrains

Product Review:BDNF antibody-middle region (ARP41970_P050) in Rhesus macaque spinal cord using IHC

Product Page for BDNF antibody-middle region (ARP41970_P050)

Researcher:Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School
Application: IHC
Species+tissue/cell type:Rhesus macaque spinal cord
Primary antibody dilution: 1:300
Secondary antibody: Donkey anti Rabbit 488
Secondary antibody dilution: 1:500

Questionnaire:
1.Fixation method
-Perfusion by 4%PFA
2.Antigen retrieval method used
- permeabilization by 0.1% Triton X100
3.Primary antibody dilution
- All 1/300
4.Secondary antibody
-Donkey anti Rabbit 488
5.Secondary antibody dilution
-1/500

 
X
Ask a Question