BAP1 Antibody - C-terminal region (ARP63861_P050)

Catalog No: ARP63861_P050

WB Suggested Anti-BAP1 Antibody
Positive Control: Lane 1: 30ug Zebrafish skin lysate Lane 2: 30ug Zebrafish liver lysate
Primary Antibody Dilution : 1:1000
Secondary Antibody : Anti-rabbit-HRP
Secondry Antibody Dilution : 1:4000
Submitted by: William Tse

Product Info

• Tested Species Reactivity: Zebrafish
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
• Peptide Sequence: Synthetic peptide located within the following region: TFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKPDRRKRSRPYKA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-BAP1 (ARP63861_P050) antibody is Catalog # AAP63861

Target Info

• Gene Symbol: BAP1
• Gene Full Name: BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
• Alias Symbols: UCHL2, hucep-6, HUCEP-13
• NCBI Gene Id: 8314
• Protein Name: Ubiquitin carboxyl-terminal hydrolase BAP1
• Description of Target: The protein encoded by this gene localizes to the nucleus and it interacts with the RING finger domain of the breast cancer 1, early onset protein (BRCA1). This gene is thought to be a tumor suppressor gene that functions in the BRCA1 growth control pathway. There are multiple polyadenylation sites found in this gene.
• Uniprot ID: Q92560
• Protein Accession #: NP_004647
• Nucleotide Accession #: NM_004656
• Protein Size (# AA): 729
• Molecular Weight: 80kDa
• Protein Interactions: ASXL1; INO80; HIST2H2AC; BRCA1; HCFC1; UBC; UBE2O; USP2; OGT; HIST2H2AA3; TRIM63; USP28; USP21; USP15; ZNF131; YY1; FOXK2; HSPA9; HSPA1A; ELF2; FOXK1; KDM1B; PRDM10; ASXL2; ZC3H13; EFNA2; Bap1; PTEN; ANKRD17; HAT1; HSPA2; IPO4; ANAPC7; AHCYL2; CBX3; CBX1;